<?xml version="1.0" encoding="UTF-8"?>
<urlset xmlns="http://www.sitemaps.org/schemas/sitemap/0.9" xmlns:image="http://www.google.com/schemas/sitemap-image/1.1" xmlns:xhtml="http://www.w3.org/1999/xhtml" xmlns:video="http://www.google.com/schemas/sitemap-video/1.1">
  <url>
    <loc>https://www.discngine.com/blog</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2026/3/12/efficient-structure-activity-relationship-sar-reporting-and-exploration-discover-discngine-ideation-sar-slides</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/48f1e189-d8f0-4e24-9c5a-d57f2d00dbbb/Manual+SAR+reporting+article.png</image:loc>
      <image:title>Blog - Efficient Structure-Activity Relationship (SAR) Reporting and Exploration in Drug Discovery: Discover Discngine Ideation SAR Slides - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4187519c-06b3-4f6c-be42-1d8e450e840d/SAR+Slides+success+story+image+for+social.png</image:loc>
      <image:title>Blog - Efficient Structure-Activity Relationship (SAR) Reporting and Exploration in Drug Discovery: Discover Discngine Ideation SAR Slides - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/744764e6-cce3-498b-ae33-26274545b1bf/Ideation+and+9+more+pages+-+Work+-+Microsoft%E2%80%8B+Edge+18-Jun-25+3_13_53+PM.png</image:loc>
      <image:title>Blog - Efficient Structure-Activity Relationship (SAR) Reporting and Exploration in Drug Discovery: Discover Discngine Ideation SAR Slides - Make it stand out</image:title>
      <image:caption>Ideation SAR Slides report preview: Collection of all datasets relevant compounds organized in highlighted, color-coded floating bubbles</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/b8178bd2-e2f9-49b2-986b-06b827a20e62/matrix+view.png</image:loc>
      <image:title>Blog - Efficient Structure-Activity Relationship (SAR) Reporting and Exploration in Drug Discovery: Discover Discngine Ideation SAR Slides - Make it stand out</image:title>
      <image:caption>Ideation SAR Slides scaffold comparison in the Matrix view: Allows side-by-side scaffold comparison, helpingUsers can users quickly analyze differences and similarities across chemical series for in-depth SAR exploration.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2026/3/ideation-sar-slides-gets-patent-searches-with-gostar-integration</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/95939da0-f880-4077-8980-4108c8afed65/Patent+search+NEW+%28Time+0_00_2</image:loc>
      <image:title>Blog - Ideation SAR Slides Gets Patent Searches with GOSTAR™ Integration - Make it stand out</image:title>
      <image:caption>Discngine Ideation SAR Slide: “Import Patent Data” search function</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2026/03/03/the-hidden-costs-of-manual-sar-reporting-in-drug-discovery</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1772543958010-C0FRQOO4P9YN2HQOEAO7/Example+multi-vector+SAR+exploration.png</image:loc>
      <image:title>Blog - The 3 Hidden Costs of Manual SAR Reporting in Drug Discovery - Make it stand out</image:title>
      <image:caption>Figure 1. Example of multi-vector SAR exploration in a medicinal chemistry program</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ea7cd9df-836c-4626-899d-df2f26becea4/SAR+matrix</image:loc>
      <image:title>Blog - The 3 Hidden Costs of Manual SAR Reporting in Drug Discovery - Make it stand out</image:title>
      <image:caption>Figure 2. Structure–Activity Relationship Matrix (SARM).¹</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7e649bc5-572c-45e1-8a60-729786f7581e/Structure-activity-relationship-SAR-analysis-of-the-3-phenylcoumarin-derivatives.webp</image:loc>
      <image:title>Blog - The 3 Hidden Costs of Manual SAR Reporting in Drug Discovery - Make it stand out</image:title>
      <image:caption>Figure 3. Structure-activity relationship (SAR) analysis of the 3-phenylcoumarin derivatives.²</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2026/01/08/accelerating-early-antibody-discovery-with-ensemble-based-developability-assessment-3dpredict-ab</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/029f79d6-33b2-499c-9a04-66f8d89dc37d/Antibody+developability+properties.png</image:loc>
      <image:title>Blog - Accelerating early antibody discovery with ensemble-based developability assessment: 3dpredict/Ab - Make it stand out</image:title>
      <image:caption>Fig 1. Antibody developability parameter</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/02b0037f-c526-4a55-a200-93b40197424c/NEW+screenshot.png</image:loc>
      <image:title>Blog - Accelerating early antibody discovery with ensemble-based developability assessment: 3dpredict/Ab - Make it stand out</image:title>
      <image:caption>Fig 2. 3dpredict/Ab detects and scores antibody liability risks</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0f617e1e-2e49-46f3-98a9-95bdbf7c2962/Physics-based+methodology+behind+3dpredict%2FAb</image:loc>
      <image:title>Blog - Accelerating early antibody discovery with ensemble-based developability assessment: 3dpredict/Ab - Make it stand out</image:title>
      <image:caption>Fig 3. Computational method for ensemble sampling of antibody conformations across pH</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1dbe4e3b-1906-4efa-baf1-da875e586eba/Antibody+candidate+profiling+against+clinical+stage+therapeutics</image:loc>
      <image:title>Blog - Accelerating early antibody discovery with ensemble-based developability assessment: 3dpredict/Ab - Make it stand out</image:title>
      <image:caption>Fig 4. 3dpredict/Ab’s Overview window for descriptor-based comparison of candidates with clinical-stage antibodies</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2025/10/31/highlights-from-discngine-meetup-vol-5</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/67f8c597-8b0d-4c4c-b036-b9a3d2793c45/Banner+Discngine+Meetup+Vol.+5</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 5: Pushing boundaries in peptide discovery with innovative science and technology - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c24baa91-5a09-4bd2-9155-c8e7bde5e584/Presentation+on+Peptide+industry+trends</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 5: Pushing boundaries in peptide discovery with innovative science and technology - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/75f47551-2aea-400f-a582-893dfdb38b7b/Discngine+Meetup+agenda</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 5: Pushing boundaries in peptide discovery with innovative science and technology - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/823de4e6-d139-438e-9953-3eb8c598014d/Discngine+support+for+charity</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 5: Pushing boundaries in peptide discovery with innovative science and technology - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/30a6b3f1-aaa9-4aa8-adff-e92a27fd2f49/Bicyclic+peptide+visualization</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 5: Pushing boundaries in peptide discovery with innovative science and technology - Make it stand out</image:title>
      <image:caption>3D Model of a Bicyclic Peptide (Visualized in 3decision)</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e0816c1c-6af5-462c-8003-5b402346cc98/Peptides+compared+to+small+molecules+and+biologics</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 5: Pushing boundaries in peptide discovery with innovative science and technology - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2025/7/2/rna-as-a-drug-target-book-highlight-how-targeting-rna-emerges-as-the-next-frontier-for-medicinal-chemistry</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/db12fc4f-1f64-42af-93f2-32b9ae5c90ce/1750930809502.png</image:loc>
      <image:title>Blog - “RNA as a Drug Target” Book Highlight: How targeting RNA emerges as the next frontier for medicinal chemistry - Make it stand out</image:title>
      <image:caption>An example of a K homology (KH) domain of a protein (KH1 in blue and KH2 in green) binding to RNA (in pink) (PDB: 2ATW). This interaction is significant for drug targeting. The structure is visualized using Discngine's 3decision® application, where the Annotation Browser automatically highlights the KH domains.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/14cb9315-1f8f-4967-a8a4-af75b2c4df50/1750930809191.png</image:loc>
      <image:title>Blog - “RNA as a Drug Target” Book Highlight: How targeting RNA emerges as the next frontier for medicinal chemistry - Make it stand out</image:title>
      <image:caption>Example of an RNA-only structure from the PDB (PDB: 7SHX). This NMR structure shows how a single nucleotide change (C to A, highlighted in white) can reshape the architecture of a non-coding RNA, modulating gene expression over long distances. In this example, such structural variation reduces gene expression. The structure is visualized using Discngine's 3decision® application.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/cded5098-7ef1-4913-93dd-0af92d074157/1750930808920.jpg</image:loc>
      <image:title>Blog - “RNA as a Drug Target” Book Highlight: How targeting RNA emerges as the next frontier for medicinal chemistry - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2025/3/14/efficient-sar-analysis-and-reporting-for-rapid-compound-optimizationdiscngine-bayer-success-story</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/cb432523-671a-460b-a050-6ce6c242c1f8/bayer+logo.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/88908599-b594-4ee2-a1bc-0e4ddf64a33f/Britta+logo.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/dd36a95e-71c7-414b-b9a7-e138d49ee7b1/Janosch+circle.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/05d73d8d-3dec-4ce7-9376-2b7324c6e56b/David+%2B+logo.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/b31d0570-6ae8-4691-aaeb-3cd2b3619682/Aurelie+%2B+logo.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/856056d3-6dbd-4e6e-915a-da907c005737/structure+activity+relationship+report+and+analysis+medicinal+chemistry+drug+discovery</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1742217858984-9EBBJ7QPWWFCGIKXPA1N/MMPs+-+MMS+Workflow.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1742217858981-ZX8A7V594KLG9H9NMKV0/MMPs+-+MMPs+Workflow.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1742218942394-28C2F9F9JVCLW2B4RNK1/SAR+Slides+-+MMPs+SAR+Slide.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story - Make it stand out</image:title>
      <image:caption>SAR Slides application: Chemists can easily import and update their datasets, establish and visualize automatically organized SAR reports and associated metadata, ensure consistency in font size, style and alignment as well as identify trends and insights within datasets. The image is based on MMPs identification methodologies. (click to zoom in)</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1742218941522-AZFXSF0CK7KU2DWNKMB1/SAR+Slides+-+R-Group+SAR+Slide.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story</image:title>
      <image:caption>SAR Slides application: Example of R-Group deconvolution-based SAR slides</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1742218941224-0GS1BPY5LUAR896NR4IX/SAR+Slides+-+Browse+R-Groups.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story</image:title>
      <image:caption>SAR Slides application: Example of associated R-Group table browsing capabilities</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1576003115652-5G2O8XTFOQ4WI8IQZQKU/problem+solving+mindsetHD.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/426c7b00-ba86-4530-9096-a1c60d83bd2e/Accelerated+innovation+%282%29.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e6ed1f55-331a-414d-ba89-1a8783a94e3a/Improved+collaboration+%282%29.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/df80002d-6567-4bf7-9396-3823dcbb5556/Laurent+Bialy+logo.png</image:loc>
      <image:title>Blog - Efficient SAR analysis and reporting for rapid compound optimization: A Discngine-Bayer success story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2024/10/9/highlights-discngine-meetup-vol-4</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1719499023873-Y6SD24G0J9S7L8PPCQ0Z/Banniere_green_FINAL.png</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 4: Biotherapeutic developability assessment strategies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/a07f0e48-a589-4318-8be5-ef6a353c30d7/Re%CC%81union+Microsoft+Teams+_+Altman+partners+SARL+_+claude%40altman-partners.com+_+Microsoft+Teams+08_10_2024+16_08_08.jpg</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 4: Biotherapeutic developability assessment strategies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2261f5e2-8a93-44dd-8078-d35ccdb57547/Screenshot+2024-10-08+at+8.58.45%E2%80%AFAM.jpg</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 4: Biotherapeutic developability assessment strategies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/beb9abf9-5a4f-4476-b0aa-bdd7007b2bf1/Screenshot+2024-10-08+at+9.16.31%E2%80%AFAM.jpg</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 4: Biotherapeutic developability assessment strategies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bf8325fa-8f6c-46bf-9247-256dd2dd25a3/Picture4.png</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 4: Biotherapeutic developability assessment strategies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ddb68ab5-19dc-4d99-92eb-92d0a5fbcda7/Video2.PNG</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 4: Biotherapeutic developability assessment strategies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0a54df48-5eb6-46d0-a3b0-d4a2803159ba/Video3.PNG</image:loc>
      <image:title>Blog - Highlights from Discngine Meetup Vol. 4: Biotherapeutic developability assessment strategies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2024/6/4/celebrating-20-years-of-software-for-new-molecule-discovery-discngines-milestone-anniversary</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/88d969a2-0bbc-4bd4-a80b-ae157efd1316/Disncgine---20-ans---A5.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary! - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500315737-3MDH3O1LIKHSWA17JT77/_IMG2754.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500309715-UEX0IH0RZY1GBLJ7QKT0/_IMG2590.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500308498-863WXJ3YJ47R1GFG4G5D/_IMG2552.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717495363531-2J1B41P19X8L6APNIC3S/DNG_0280.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500313404-SZVAVGC9TXSESIRRHCLO/_IMG2695.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500308314-KSZJB2TG15LZHH6K9AYT/_IMG2577.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500315094-60LHK3L9AFOQBPWSYRQC/_IMG2747.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500316755-JICMKQPJJC6N8DRZIVQO/_IMG2755.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500317476-9AOGY0R78MBXNXQ9Q0RW/_IMG2769.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500309909-K3KQXBI0SS4D2NGWKPT5/_IMG2625.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500311040-NGF966WOWZJER5UCJANZ/_IMG2642.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717495344782-AUUKI4LOEXL6KHBAY2NX/446890698_973706030748407_4239977864275936096_n.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717495350805-3FFA5G17WC263DQA84U8/DNG_0229.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500306773-4IIQMIV0V16HABJZCOVU/_IMG2473.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717495342606-4701FTQ5YCIN0FA1ZI5X/_IMG2910.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500311381-25MYZY05I8P14W62AL1D/_IMG2678.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717495354646-35BL75P24RHDFZN8GV2R/DNG_0230.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500312560-9SEQL8TWGGLLFQTNNN65/_IMG2693.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717495358625-LXUT3QVCS9PCSPRT6F5Z/DNG_0245.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500314275-BA8OUYMJASPZBESAP2SC/_IMG2718.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717495361000-3VYAVLWEPJ4C1ULP9LK5/IMG_0178.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717495342467-SJG5M4GHAIPE801LGCC7/_IMG2462.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500318604-F7WLOCPU0R907IT7IPW0/_IMG2854.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500319066-GBFABU8U1NN6R80B6WGL/_IMG2861.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1717500320118-GWB3DGGS80E4ZO495HGM/_IMG2910.jpg</image:loc>
      <image:title>Blog - Celebrating 20 Years of software for new molecule discovery: Discngine's Milestone Anniversary!</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2024/4/25/discngine-achieves-iso-27001-2022-certification-enhancing-security-and-trust-for-our-customers</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ca3f083e-ae5e-4db1-83b4-04c9f7ec48f6/ISO_Logo_%28Red_square%29.svg.png</image:loc>
      <image:title>Blog - Discngine Achieves ISO 27001:2022 Certification: Enhancing Security and Trust for Our Customers - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bff480db-a044-43b5-ad28-ad1c6c68162c/first+page+FINAL+frame.png</image:loc>
      <image:title>Blog - Discngine Achieves ISO 27001:2022 Certification: Enhancing Security and Trust for Our Customers - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2024/3/4/streamlining-project-presentations-and-drug-discovery-with-knime-and-birt</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3151f908-be2d-4040-b5a1-99e5a5d3cfe0/fullWF.png</image:loc>
      <image:title>Blog - Streamlining Project Presentations with BIRT: A Chemical Library Enumeration KNIME  Workflow Use Case - Make it stand out</image:title>
      <image:caption>Figure 1. General overview of the whole workflow.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0c287f4e-fea2-45df-9489-57a4b74f0c89/Inputs.png</image:loc>
      <image:title>Blog - Streamlining Project Presentations with BIRT: A Chemical Library Enumeration KNIME  Workflow Use Case - Make it stand out</image:title>
      <image:caption>Figure 2 Input selection in the workflow.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/782beef9-0f24-415a-bc0d-7cb2800ea194/Graphical+Interface+input.png</image:loc>
      <image:title>Blog - Streamlining Project Presentations with BIRT: A Chemical Library Enumeration KNIME  Workflow Use Case - Make it stand out</image:title>
      <image:caption>Figure 3 Graphical interface for data input. A) SDF file loading page and B) Skechers input page.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f2714759-eeb7-4b7e-80ac-ca138da46e5e/Add+reaction+comb.png</image:loc>
      <image:title>Blog - Streamlining Project Presentations with BIRT: A Chemical Library Enumeration KNIME  Workflow Use Case - Make it stand out</image:title>
      <image:caption>Figure 4 Input the wanted reaction.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1a44b403-a933-4ff5-9c04-4c699f403ced/Enumerate.png</image:loc>
      <image:title>Blog - Streamlining Project Presentations with BIRT: A Chemical Library Enumeration KNIME  Workflow Use Case - Make it stand out</image:title>
      <image:caption>Figure 5 Enumeration.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d81e6dab-07f8-49e2-9598-c385ec7d2611/Calculate+Properties.png</image:loc>
      <image:title>Blog - Streamlining Project Presentations with BIRT: A Chemical Library Enumeration KNIME  Workflow Use Case - Make it stand out</image:title>
      <image:caption>Figure 6 Calculate molecular properties.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/9ab36562-aa1a-4ee6-8d90-b32279b7672e/Reporting.png</image:loc>
      <image:title>Blog - Streamlining Project Presentations with BIRT: A Chemical Library Enumeration KNIME  Workflow Use Case - Make it stand out</image:title>
      <image:caption>Figure 7 Prepare data for the reporting.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/63afad87-d8e2-458e-93ac-0138d54b0455/icon+data+analysis+%28420+x+400+px%29.png</image:loc>
      <image:title>Blog - Streamlining Project Presentations with BIRT: A Chemical Library Enumeration KNIME  Workflow Use Case - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7c5c7d1b-0f31-43e2-9939-3438041c1941/Birt+inteface1.png</image:loc>
      <image:title>Blog - Streamlining Project Presentations with BIRT: A Chemical Library Enumeration KNIME  Workflow Use Case - Make it stand out</image:title>
      <image:caption>Figure 8 BIRT editor interface.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4a3327f3-c8f6-4bb3-add0-95f1c4f42a8d/icon+player+%28680+x+400+px%29.png</image:loc>
      <image:title>Blog - Streamlining Project Presentations with BIRT: A Chemical Library Enumeration KNIME  Workflow Use Case - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6f4a3425-0170-4be8-b549-38164a0d6394/Fortmats.png</image:loc>
      <image:title>Blog - Streamlining Project Presentations with BIRT: A Chemical Library Enumeration KNIME  Workflow Use Case - Make it stand out</image:title>
      <image:caption>Figure 9 BIRT - Available formats.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2024/1/18/your-experimental-data-matters-how-can-you-protect-it-all-throughout-its-entire-lifecycle-wherever-it-is</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3dbf5c18-572b-4b2e-bafa-4e743bf13867/Image2+-+article+information+security.png</image:loc>
      <image:title>Blog - Your experimental data matters: how can you protect it all, throughout its entire lifecycle, wherever it is? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/91aa517c-cb09-4b6c-8b9d-b76ef42b0dcc/1.png</image:loc>
      <image:title>Blog - Your experimental data matters: how can you protect it all, throughout its entire lifecycle, wherever it is? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/38ddbabc-72bc-48aa-8cdc-7800028efd73/2.png</image:loc>
      <image:title>Blog - Your experimental data matters: how can you protect it all, throughout its entire lifecycle, wherever it is? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ac6c1cf6-5d89-440b-9f07-ee31aeef41a8/3.png</image:loc>
      <image:title>Blog - Your experimental data matters: how can you protect it all, throughout its entire lifecycle, wherever it is? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bff480db-a044-43b5-ad28-ad1c6c68162c/first+page+FINAL+frame.png</image:loc>
      <image:title>Blog - Your experimental data matters: how can you protect it all, throughout its entire lifecycle, wherever it is? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2024/1/3/how-discngine-assay-enhanced-overall-screening-activities-at-bayer-cropscience</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1544029627654-VP20R48I8AT48PU6KQVZ/Bayer.png</image:loc>
      <image:title>Blog - How Discngine Assay enhanced overall screening activities at Bayer CropScience - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4263a346-5d85-478b-ae06-e13ca5d17d31/Success+story+picture.png</image:loc>
      <image:title>Blog - How Discngine Assay enhanced overall screening activities at Bayer CropScience - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/15e43a0e-d851-4564-bab0-e7addb40d04f/Discngine-assay_vect.png</image:loc>
      <image:title>Blog - How Discngine Assay enhanced overall screening activities at Bayer CropScience - Make it stand out</image:title>
      <image:caption>An example of a well validation stage in Discngine Assay</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2325b6d6-d032-4b0c-8abc-6f59b6590a8d/Aure%CC%81lia.png</image:loc>
      <image:title>Blog - How Discngine Assay enhanced overall screening activities at Bayer CropScience - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2d68279d-0471-48a8-ac04-bfd68130da96/Lydie.png</image:loc>
      <image:title>Blog - How Discngine Assay enhanced overall screening activities at Bayer CropScience - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/541cd59c-73cd-4e88-8702-1260cf056733/Matthieu.png</image:loc>
      <image:title>Blog - How Discngine Assay enhanced overall screening activities at Bayer CropScience - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2023/11/8/empowering-digital-transformation-at-loral-with-discngine-assay-cloud-solution</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ad981950-1767-47a5-bcb9-413346c83d63/LOREAL_0306452_ORI.png</image:loc>
      <image:title>Blog - Empowering digital transformation at L'Oréal with Discngine Assay cloud solution - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1700073808204-VHCIGZF7DGFHRJ3R8PGH/image-asset.jpeg</image:loc>
      <image:title>Blog - Empowering digital transformation at L'Oréal with Discngine Assay cloud solution - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/28f6154b-2c54-4f18-afab-7b6b799df7da/_Assay+Home+3.gif</image:loc>
      <image:title>Blog - Empowering digital transformation at L'Oréal with Discngine Assay cloud solution - Make it stand out</image:title>
      <image:caption>An example of Discngine Assay</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/22353d9a-ce12-4ce7-8f8b-611ba9f5e900/Enhanced+productivity+%282%29.png</image:loc>
      <image:title>Blog - Empowering digital transformation at L'Oréal with Discngine Assay cloud solution - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/426c7b00-ba86-4530-9096-a1c60d83bd2e/Accelerated+innovation+%282%29.png</image:loc>
      <image:title>Blog - Empowering digital transformation at L'Oréal with Discngine Assay cloud solution - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4e32b591-f410-4391-80a4-d71484194ca1/Advanced+support+%282%29.png</image:loc>
      <image:title>Blog - Empowering digital transformation at L'Oréal with Discngine Assay cloud solution - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/47cd0cb1-e840-4c0c-939f-1dab6ffa1c3d/Ensured+security+%282%29.png</image:loc>
      <image:title>Blog - Empowering digital transformation at L'Oréal with Discngine Assay cloud solution - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e6ed1f55-331a-414d-ba89-1a8783a94e3a/Improved+collaboration+%282%29.png</image:loc>
      <image:title>Blog - Empowering digital transformation at L'Oréal with Discngine Assay cloud solution - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/cfeb56d4-f299-449a-b0cd-cfd33a62091e/Data+quality+%282%29.png</image:loc>
      <image:title>Blog - Empowering digital transformation at L'Oréal with Discngine Assay cloud solution - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2023/10/26/highlights-from-the-discngine-meetup-vol3-the-evolving-needs-in-new-drug-modalities</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1719499023873-Y6SD24G0J9S7L8PPCQ0Z/Banniere_green_FINAL.png</image:loc>
      <image:title>Blog - Highlights from the Discngine Meetup Vol.3: The Evolving Needs in New Drug Modalities - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/31c84380-6d65-4b9f-ab5a-01604d48dc3e/networking_blurred.png</image:loc>
      <image:title>Blog - Highlights from the Discngine Meetup Vol.3: The Evolving Needs in New Drug Modalities - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/62f52c20-253d-4518-a99f-2647194439f5/Screenshot+2023-10-25+at+5.47.21%E2%80%AFPM.png</image:loc>
      <image:title>Blog - Highlights from the Discngine Meetup Vol.3: The Evolving Needs in New Drug Modalities - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2023/9/29/how-discngine-enhanced-building-blocks-data-handling-for-medicinal-chemists-pharma-success-story</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/fe069d3a-90af-498e-85cc-a20190b6f05a/BBs-better.png</image:loc>
      <image:title>Blog - How Discngine enhanced building blocks data handling for Medicinal Chemists – Pharma success story - Make it stand out</image:title>
      <image:caption>Building blocks are the molecular reagents or fragments used to synthesize drug compounds.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/29dd8663-4359-41bf-9a10-ef4c35cc56d8/banner+for+the+blog5.png</image:loc>
      <image:title>Blog - How Discngine enhanced building blocks data handling for Medicinal Chemists – Pharma success story - Make it stand out</image:title>
      <image:caption>Time needed to find building block of interest with new platform developed by Discngine is 3 times faster than with legacy tools</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2023/8/9/from-legacy-system-to-discngine-assay-5-steps-to-enhance-assay-data-management</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/79d6f3ba-9aa0-4695-a0ef-524c2d28d1ed/Schema+process.png</image:loc>
      <image:title>Blog - From legacy system to Discngine Assay: 5 steps to enhance assay data management - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e0957854-88cd-414a-9189-32a87b10c12d/Step0.png</image:loc>
      <image:title>Blog - From legacy system to Discngine Assay: 5 steps to enhance assay data management - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5e058c16-d00f-4ff3-88e3-fde3f9395f8d/Step1.png</image:loc>
      <image:title>Blog - From legacy system to Discngine Assay: 5 steps to enhance assay data management - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/82678468-14b2-49a8-98d6-c5b99b197a73/Step2.png</image:loc>
      <image:title>Blog - From legacy system to Discngine Assay: 5 steps to enhance assay data management - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1689236815139-PASROEH7O4LI4SFVC6R3/Sample+-+384.png</image:loc>
      <image:title>Blog - From legacy system to Discngine Assay: 5 steps to enhance assay data management - Make it stand out</image:title>
      <image:caption>Example of a Plate Layout view in Assay</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8994da59-399f-4eb9-a6ac-0574fc4696e2/Step3.png</image:loc>
      <image:title>Blog - From legacy system to Discngine Assay: 5 steps to enhance assay data management - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2ae6fb11-5015-4991-92ab-df266a394c2c/Step4.png</image:loc>
      <image:title>Blog - From legacy system to Discngine Assay: 5 steps to enhance assay data management - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/b6c43497-2dbb-46e5-9994-a30862ba28c2/image.png</image:loc>
      <image:title>Blog - From legacy system to Discngine Assay: 5 steps to enhance assay data management - Make it stand out</image:title>
      <image:caption>Example of a Cross Runs Visualization in Assay</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/705e8271-7d48-44f6-b8b8-334f0ac5c792/Step5.png</image:loc>
      <image:title>Blog - From legacy system to Discngine Assay: 5 steps to enhance assay data management - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2023/7/7/discngine-assay-62-whats-new-in-the-new-release</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1689161974606-CYC39MTHGRM2LTS1ZM35/Reference+data+-+example+vocabulary.png</image:loc>
      <image:title>Blog - Discngine Assay 6.2 - What’s new in the new release? - Reference data - example vocabulary</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1689161974691-YNR8RS17ZKLJYNQY42OV/Reference+data+-+vocabularies+list.png</image:loc>
      <image:title>Blog - Discngine Assay 6.2 - What’s new in the new release? - Reference data - vocabularies list</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1689236664887-J4XPKINB94HZL8XB5FTW/Sample+-+Plate+view+-+Ref+data+.png</image:loc>
      <image:title>Blog - Discngine Assay 6.2 - What’s new in the new release? - Reference data - Sample plate view: Added containers annotations (in orange)</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/409c3dfe-d141-4383-82ad-bba8d3652e4e/Sample+-+Plate+view+-+focus+barcode+administration+-+website.png</image:loc>
      <image:title>Blog - Discngine Assay 6.2 - What’s new in the new release? - Make it stand out</image:title>
      <image:caption>Discngine Assay - Sample plate view: Barcode administration (in orange) - Click to Zoom In</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/265f8be7-0aae-49ce-9898-fa69b0463383/Assay+-+Generic+reader.png</image:loc>
      <image:title>Blog - Discngine Assay 6.2 - What’s new in the new release? - Make it stand out</image:title>
      <image:caption>Genetic reader - Click to Zoom In</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/07341218-faea-48c9-b054-6b18404d7c23/Assay+Catalog+-+BAO.png</image:loc>
      <image:title>Blog - Discngine Assay 6.2 - What’s new in the new release? - Make it stand out</image:title>
      <image:caption>The preview of the Discngine Assay Catalog system utilizing public ontologies (BAO) - currently in the development phase Book a meeting with our product team</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2023/5/30/five-essential-criteria-for-a-healthy-assay-data-management-system</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4ecf443e-0681-4d4b-8056-efa1ae2dc172/Pics+for+blog+VB2.png</image:loc>
      <image:title>Blog - Five essential criteria for a healthy assay data management system - Make it stand out</image:title>
      <image:caption>Click to zoom in: Based on the Bloomberg report, the global cell-based assays market size will almost double in around 10 years, reaching USD 33,8 billion by 2030, with a compound annual growth rate (CAGR) of 8,75% (from 2022 to 2030). Link here</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/31d5b6e2-1b44-4f0e-a971-ae0f781bc3af/AdobeStock_201606422.jpeg</image:loc>
      <image:title>Blog - Five essential criteria for a healthy assay data management system - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/9802d8e3-b991-4083-aef1-afa537bf6e55/image.png</image:loc>
      <image:title>Blog - Five essential criteria for a healthy assay data management system - Make it stand out</image:title>
      <image:caption>Click to zoom in. In this use case, scientists repeated the inhibition analyses nine times on the same compound. Thanks to the various colors, you can quickly check which hits belong to which analyses and compare them. The image is done with Discngine assay software.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/07341218-faea-48c9-b054-6b18404d7c23/Assay+Catalog+-+BAO.png</image:loc>
      <image:title>Blog - Five essential criteria for a healthy assay data management system - Make it stand out</image:title>
      <image:caption>Click to zoom in: The data warehouse and query are essential criteria of a good assay data management system since they allow users to make the most of their hard work on data acquisition and achieve FAIR data. The image comes from the Discngine's Assay Catalog system utilizing public ontologies (BAO) - currently in the development phase".</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2023/1/25/discngine-obtains-the-isoiec-270012013-certification-for-information-security-management</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/90b0df4c-cb73-4285-91e9-b2471f6d542e/mark-of-trust-certified-ISOIEC-27001-information-security-management-black-logo-En-GB-1019.png</image:loc>
      <image:title>Blog - Discngine obtains the ISO/IEC 27001 certification for Information Security management - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7aac118d-5a99-4112-b8a7-b9e6ae82f75a/Eric+Julien.jpg</image:loc>
      <image:title>Blog - Discngine obtains the ISO/IEC 27001 certification for Information Security management - Make it stand out</image:title>
      <image:caption>Discngine received ISO/IEC 27001 certification in January 2023.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bff480db-a044-43b5-ad28-ad1c6c68162c/first+page+FINAL+frame.png</image:loc>
      <image:title>Blog - Discngine obtains the ISO/IEC 27001 certification for Information Security management - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2022/12/2/biovia-pipeline-pilot-in-docker-good-or-bad-idea</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1633597053007-YQDU2IYBWJDIQEHRZY60/BIOVIA+Partner.png</image:loc>
      <image:title>Blog - BIOVIA Pipeline Pilot in Docker – Good or Bad Idea? Discngine’s journey of containerizing Pipeline Pilot in Docker - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/67ca4e7b-4944-4345-9aab-1951bd3b7ec9/Docker-vertical-logo-monochromatic.png</image:loc>
      <image:title>Blog - BIOVIA Pipeline Pilot in Docker – Good or Bad Idea? Discngine’s journey of containerizing Pipeline Pilot in Docker - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5cde2faf-20c8-400d-b833-44c6097b58b1/Pipeline+Pilot+IaaS+deployment.png</image:loc>
      <image:title>Blog - BIOVIA Pipeline Pilot in Docker – Good or Bad Idea? Discngine’s journey of containerizing Pipeline Pilot in Docker - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d769b42d-b921-4be9-a9ef-a578647f83b2/PP+docker+Build.png</image:loc>
      <image:title>Blog - BIOVIA Pipeline Pilot in Docker – Good or Bad Idea? Discngine’s journey of containerizing Pipeline Pilot in Docker - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1506982624435-DE4K6XTSQR7U3LXJV2AP/dockerPP.png</image:loc>
      <image:title>Blog - BIOVIA Pipeline Pilot in Docker – Good or Bad Idea? Discngine’s journey of containerizing Pipeline Pilot in Docker - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/fb853bae-8392-4995-8561-e10b5a5c866e/delivery-box.png</image:loc>
      <image:title>Blog - BIOVIA Pipeline Pilot in Docker – Good or Bad Idea? Discngine’s journey of containerizing Pipeline Pilot in Docker - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0a044f0a-46e7-4708-9627-a8dc78d34ad7/warning.png</image:loc>
      <image:title>Blog - BIOVIA Pipeline Pilot in Docker – Good or Bad Idea? Discngine’s journey of containerizing Pipeline Pilot in Docker - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7087ae3d-03cb-4e7a-bb52-038fa490b5db/arrows.png</image:loc>
      <image:title>Blog - BIOVIA Pipeline Pilot in Docker – Good or Bad Idea? Discngine’s journey of containerizing Pipeline Pilot in Docker - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/11aefb44-f407-4196-b177-d0ccc86b8dbf/flexibility.png</image:loc>
      <image:title>Blog - BIOVIA Pipeline Pilot in Docker – Good or Bad Idea? Discngine’s journey of containerizing Pipeline Pilot in Docker - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2022/4/28/how-sanofi-scientists-streamlined-their-impurity-hazard-assessment-by-working-with-discngine</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bd667526-659e-4ed8-9f3a-5089c2da612e/Logo_Sanofi_%282022%29.png</image:loc>
      <image:title>Blog - How Sanofi scientists streamlined their in silico hazard assessment of potential genotoxic impurities by collaborating with Discngine - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1630708073219-PZK46OX1IEEC1GJIGQEC/Alexander.png</image:loc>
      <image:title>Blog - How Sanofi scientists streamlined their in silico hazard assessment of potential genotoxic impurities by collaborating with Discngine - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1623680563552-FJ0882PRCA49XWP9VXYB/Alain.png</image:loc>
      <image:title>Blog - How Sanofi scientists streamlined their in silico hazard assessment of potential genotoxic impurities by collaborating with Discngine - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/cd6635b8-8a88-4491-a6b0-4caf494fdb6b/MILTAP+Impurities.png</image:loc>
      <image:title>Blog - How Sanofi scientists streamlined their in silico hazard assessment of potential genotoxic impurities by collaborating with Discngine - Make it stand out</image:title>
      <image:caption>MILTAP application interface: Impurities list -&gt; Click to zoom in</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/cebd2da9-d2b7-468d-908a-ebe4b27750d2/MILTAP+Assessment.png</image:loc>
      <image:title>Blog - How Sanofi scientists streamlined their in silico hazard assessment of potential genotoxic impurities by collaborating with Discngine - Make it stand out</image:title>
      <image:caption>MILTAP application interface: Impurity Assessment -&gt; Click to Zoom in</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2022/7/27/a-new-release-58-of-the-spotfire-connector-for-pipeline-pilot-is-available</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e82286b0-476e-4a52-a33e-2061c9a90bfb/Kubernetes-Logo-full.png</image:loc>
      <image:title>Blog - A new release (5.8) of the Spotfire Connector for Pipeline Pilot is available - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1658930681633-0K35156G07H0U0K3PA79/Df+tuning.png</image:loc>
      <image:title>Blog - A new release (5.8) of the Spotfire Connector for Pipeline Pilot is available - Tune Data Function parameters in the visualization panels</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1658930681327-MQ4AG9NWAXHEO7H0XLV7/PP+DF+Canvas+in+WP.png</image:loc>
      <image:title>Blog - A new release (5.8) of the Spotfire Connector for Pipeline Pilot is available - Data Function Lineage in Canvas view</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1658930682374-V7QYXMU72HMASQG2IOBW/PP+DF+in+WP.png</image:loc>
      <image:title>Blog - A new release (5.8) of the Spotfire Connector for Pipeline Pilot is available - Insert Pipeline Pilot (or KNIME) Data Functions directly in Spotfire Web Player</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1658931243201-0RS3MYMJUPHAN7VNFI0T/Dng+cards+mods+Light.png</image:loc>
      <image:title>Blog - A new release (5.8) of the Spotfire Connector for Pipeline Pilot is available - Discngine Cards Mod</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1658931243077-L0ZSJI5QPQZ7ZK51D2P8/dng+sunburst+mod.png</image:loc>
      <image:title>Blog - A new release (5.8) of the Spotfire Connector for Pipeline Pilot is available - Discngine Sunburst Mod for Hierarchical Clustering</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1673f44f-ae32-4c4e-b71a-c94dd1ab9cd2/doc+versionign+small.png</image:loc>
      <image:title>Blog - A new release (5.8) of the Spotfire Connector for Pipeline Pilot is available - Make it stand out</image:title>
      <image:caption>Spotfire Library Versioning UI</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3283b69d-6506-49a6-8009-9e89269b59fc/Web+Panel+Chromium.png</image:loc>
      <image:title>Blog - A new release (5.8) of the Spotfire Connector for Pipeline Pilot is available - Make it stand out</image:title>
      <image:caption>New Chromium-based Web Panel for Spotfire Analyst</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/12430f51-4aa8-4ab4-a5b2-15848f03a5df/whatsnew_data_transfo.png</image:loc>
      <image:title>Blog - A new release (5.8) of the Spotfire Connector for Pipeline Pilot is available - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2022/6/22/flag-aggregator-compounds-during-hts-triage-enhanced-visualization-with-tibco-spotfire-connector-for-knime</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c8c88d2b-3a04-416b-b1e3-f868f9be9ec8/image+%2825%29.png</image:loc>
      <image:title>Blog - Flag aggregator compounds during HTS Triage – Enhanced visualization with TIBCO Spotfire® Connector for KNIME - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/eba6a85b-a6aa-4b9f-b364-c51d25d1a051/image+%2826%29.png</image:loc>
      <image:title>Blog - Flag aggregator compounds during HTS Triage – Enhanced visualization with TIBCO Spotfire® Connector for KNIME - Make it stand out</image:title>
      <image:caption>KNIME Workflow 0_MAIN</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0c4b9149-83cf-4311-a97f-1852b62e1ebd/1_Workflow_repo.png</image:loc>
      <image:title>Blog - Flag aggregator compounds during HTS Triage – Enhanced visualization with TIBCO Spotfire® Connector for KNIME - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/a54626b7-82d1-47e5-b943-20e7aa3d062b/2_Workflow_params.png</image:loc>
      <image:title>Blog - Flag aggregator compounds during HTS Triage – Enhanced visualization with TIBCO Spotfire® Connector for KNIME - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/08162e93-5994-49da-a69b-c6a4c146cdb7/TableAUC.PNG</image:loc>
      <image:title>Blog - Flag aggregator compounds during HTS Triage – Enhanced visualization with TIBCO Spotfire® Connector for KNIME - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1dc8ba28-2416-4326-bad4-c73415aa86d2/image+%2827%29.png</image:loc>
      <image:title>Blog - Flag aggregator compounds during HTS Triage – Enhanced visualization with TIBCO Spotfire® Connector for KNIME - Make it stand out</image:title>
      <image:caption>Specific PSIC workflow.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/a9e1f661-84d3-4f64-b826-82553db7cc04/3_Trellis.PNG</image:loc>
      <image:title>Blog - Flag aggregator compounds during HTS Triage – Enhanced visualization with TIBCO Spotfire® Connector for KNIME - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/89369cc0-564b-485f-92e1-d77c90312df9/4_TreeMap.PNG</image:loc>
      <image:title>Blog - Flag aggregator compounds during HTS Triage – Enhanced visualization with TIBCO Spotfire® Connector for KNIME - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d3699750-47ed-4063-b0b8-c716b893aa10/SCAM.gif</image:loc>
      <image:title>Blog - Flag aggregator compounds during HTS Triage – Enhanced visualization with TIBCO Spotfire® Connector for KNIME - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2022/5/18/discngine-at-the-bio-it-world-conference-amp-expo</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8856d397-2e69-40c8-a363-08a685a9c294/BIT22-300x250.jpeg</image:loc>
      <image:title>Blog - Discngine at the Bio-IT World Conference &amp;amp; Expo - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/da2dc176-fcde-47f8-a796-51858f188f80/Image+from+iOS.jpg</image:loc>
      <image:title>Blog - Discngine at the Bio-IT World Conference &amp;amp; Expo - Make it stand out</image:title>
      <image:caption>Mingxi Song from Takeda was our Raffle winner! He brought back home a VR headset!</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f7339494-06d0-48c2-808a-2dbd14966d10/Banner_DNGLabs+VR1.png</image:loc>
      <image:title>Blog - Discngine at the Bio-IT World Conference &amp;amp; Expo - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2022/4/26/how-to-prettify-oracle-cloud-infrastructure-notifications-with-microsoft-power-automate</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3692cd23-4a55-4927-b421-8055a1b721e4/1.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Figure 1: A raw OCI slack notification</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d41f9fb4-8747-41ef-94ef-dbf3cc27ea33/2.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Figure 2: The same notification after being formatted by a PowerAutomate flow</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0d968321-1ccf-4518-9d49-e1899db2d7ff/3bis.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2c32cc4d-9579-430b-820c-6c1fc5747c1c/3.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Figure 3: Topic subscription confirmation</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/743da51b-c088-43ce-bfb5-cfb3aa1cbf61/4.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Figure 4: Power Automate flow HTTP request listener</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ef5c61ea-06c7-4ea3-8da8-57c70e1d3883/5.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Figure 5: API Gateway creation</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c6cb5f88-6687-4433-8176-36964608364f/6.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Figure 6: API Gateway deployment creation</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/312a4e24-e630-48cd-9b71-45f38630309f/7.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Figure 7: API Gateway Deployment Route configuration</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/beb7c9b1-0161-406f-8a2c-dab7e5769573/8.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Figure 8: API Gateway Deployment Route additional parameters configuration</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/9b899e8f-254b-4743-a11b-1c572115e902/9.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Figure 9: Postman test of the API Gateway</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1fe62e98-722b-4839-b619-175fc5cdbdc7/10.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Figure 10: Treating confirmation with a control condition sending this call to a dedicated branch of the flow</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f932e1c2-4810-4c95-8b76-0b830836e9c8/11.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Figure 11: Reading OCI alerts and sending them to slack</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/329a1140-a457-40f4-b85c-4d81f543ce93/12.png</image:loc>
      <image:title>Blog - How to prettify Oracle Cloud Infrastructure notifications with Microsoft Power Automate? - Make it stand out</image:title>
      <image:caption>Figure 12: Example of Slack message</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2022/4/19/discngine-labs-discngine-connector-for-livedesign-event-highlights</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ada7d1a8-cfb8-42f6-9a9f-e9d412450003/DNG+Labs+blurred_blog.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Make it stand out</image:title>
      <image:caption>First Discngine Labs event on Gather</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650384898510-HRARSN28F6T3IFDCDT8M/LiveDesign+-+Google+Chrome+19_04_2022+15_52_53.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 1: Open LiveReport in LiveDesign</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650441259482-I8CWXSIM216TG0DPAJTZ/LiveDesign+-+Google+Chrome+19_04_2022+15_57_25.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 2: Open Gadgets from the left side menu and choose “ BIOVIA PipelinePilot Gadget by Discngine"</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650384900274-HU5VXYCGN50RABR50HEF/LiveDesign+-+Google+Chrome+19_04_2022+15_54_39.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 3: Pick the PipelinePilot protocol from the Menu bar</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650384895910-W3XQQ0V3TPEJ2913XS4D/LiveDesign+-+Google+Chrome+19_04_2022+15_55_04.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 4: Select a molecule in the LiveReport and enter Search parameters and press “Submit”</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650384896913-85CSFZN1Q9CIEOLHBZD2/LiveDesign+-+Google+Chrome+19_04_2022+15_55_18.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 5: The Pipeline Pilot protocol is running asynchronously</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650384898333-LUZG8D1R2OKZCOEEWDMN/LiveDesign+-+Google+Chrome+19_04_2022+15_55_59.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 6: Review similar molecules found, press “Add molecules” to add it to your LiveReport</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650441259482-I8CWXSIM216TG0DPAJTZ/LiveDesign+-+Google+Chrome+19_04_2022+15_57_25.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 1: Open “TIBCO Spotfire Gadget by Discngine”</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650441199975-KPIGOM1AH8DVBV1JVVQD/LiveDesign+-+Google+Chrome+19_04_2022+16_05_25.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 2: The Spotfire Connector Gadget is searching for default Spotfire template</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650441212999-ZXZ16GOKMTCAWC8LXS7K/LiveDesign+-+Google+Chrome+19_04_2022+16_11_16.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 3: LiveReport data is injected in the Spotfire template</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650441226315-0ZG4GYKGNMXU5R61RCND/LiveDesign+-+Google+Chrome+19_04_2022+16_11_22.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 4: Marking/Filtering are synchronized between LiveDesign and Spotfire</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650441238796-O6HOZEWSC8HR6CR6WP5Q/LiveDesign+-+Google+Chrome+19_04_2022+16_11_26.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 5: Spotfire integration capabilities allow drill down to detailed experimental data</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650441250104-1YCHIPHYIAOIOCC2M5V5/LiveDesign+-+Google+Chrome+19_04_2022+16_11_40.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 6: Molecular structures are displayed in any visualizations</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1774518964963-PCGWWB6OVQ7HXNLMCAPV/step+1.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 1: Open the LiveDesign data source from the plus menu</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1774518969571-21G8SP5VXPIN6POC3X4O/step2_better_final.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 2: Enter the LiveReport parameters</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1774518996404-AVFS1VCX23SEZVQ5K91T/step+3.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 3: Import and convert molecules</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1774519028596-VDIW0T1K8QD27V42MSNC/TIBCO+Spotfire+19_04_2022+16_15_38.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 4: Create a new data table with LiveReport data</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1774519032808-AUUJGQU80S36JGJJKGYY/TIBCO+Spotfire+19_04_2022+16_16_00.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Step 5: Use Spotfire visualization to render LiveReport data</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2b870586-cba4-4425-a0f1-6b0f37deba74/roundtable.PNG</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Make it stand out</image:title>
      <image:caption>Roundtable panel discussion</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5bd83874-7101-4592-abd7-fca4bd38bec7/Screen+Shot+2022-04-14+at+7.52.08+AM.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/576fa8cf-28dc-4be4-8e8d-31e5f2689bc0/bar+5+-+blurred.png</image:loc>
      <image:title>Blog - Discngine Labs: Discngine Connector for LiveDesign® [Event highlights] - Make it stand out</image:title>
      <image:caption>Virtual Bar</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2022/3/22/ai-in-drug-discovery-an-ai-focused-conference-with-precious-insights-from-the-pharma-and-biotech-industry</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2022/2/4/discngine-is-poised-to-become-a-european-leader-in-life-sciences-research-informatics</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2022/2/1/artificial-intelligence-in-drug-design-book-highlights-what-can-you-learn-about-the-latest-trends-of-ai-in-pharma</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2022/1/21/two-years-later-a-look-back-on-our-new-recognition-system</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1a42da27-f27b-4187-afb5-56bb119ed9c8/Recognition+System+Article+-+Image.png</image:loc>
      <image:title>Blog - Two years later: a look back on our new recognition system - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2021/11/9/digital-discovery-meetup-the-first-discngine-community-gathering</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/36105ceb-8e6c-4342-b846-a84bc8f824d1/Banniere_finale.png</image:loc>
      <image:title>Blog - Digital Discovery Meet Up - the first Discngine community gathering - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/509651da-999c-4d67-bedd-1ca8d235141b/image+%286%29+-+Copy.png</image:loc>
      <image:title>Blog - Digital Discovery Meet Up - the first Discngine community gathering - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4cd7b228-7051-48a6-ab64-e33266c23bf8/gg_horizontal_color_300.png</image:loc>
      <image:title>Blog - Digital Discovery Meet Up - the first Discngine community gathering - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2021/7/1/visualize-your-chemical-space-by-connecting-knime-and-tibco-spotfire-introduction-to-the-swak</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1624659955723-898OLDXEESEIBSWUV2E3/Knime+workflow.png</image:loc>
      <image:title>Blog - Visualize your chemical space by connecting KNIME and TIBCO Spotfire®: Introduction to the SWAK - Make it stand out</image:title>
      <image:caption>KNIME Workflow developed to visualize the chemical space of the Malaria Dataset with the Discngine SWAK.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1624661716463-CJJ5DTO3FET6WK7QEE2L/Picture2.png</image:loc>
      <image:title>Blog - Visualize your chemical space by connecting KNIME and TIBCO Spotfire®: Introduction to the SWAK - Make it stand out</image:title>
      <image:caption>Expended view of the Compute fingerprint and PCA metanode.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1624662150415-FRC2NUX7FQD7BZHOC8M5/Picture3.png</image:loc>
      <image:title>Blog - Visualize your chemical space by connecting KNIME and TIBCO Spotfire®: Introduction to the SWAK - Make it stand out</image:title>
      <image:caption>SWAK interface with the connector on the left, and TIBCO Spotfire® interface on the right.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1624662215370-8PMM72IFHQ0K6AELTH98/SWAK-demo-gif2.gif</image:loc>
      <image:title>Blog - Visualize your chemical space by connecting KNIME and TIBCO Spotfire®: Introduction to the SWAK - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1624662271276-MS6SE30GHTG83ADU9RCF/SWAK-demo-gif3.gif</image:loc>
      <image:title>Blog - Visualize your chemical space by connecting KNIME and TIBCO Spotfire®: Introduction to the SWAK - Make it stand out</image:title>
      <image:caption>The input parameters were added in the connector interface, and the job is now running.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1624662314343-0CEPOUAQOR9LVWIFDO5J/Picture4.png</image:loc>
      <image:title>Blog - Visualize your chemical space by connecting KNIME and TIBCO Spotfire®: Introduction to the SWAK - Make it stand out</image:title>
      <image:caption>Visualization of Malaria Dataset within the chemical space.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1624662430424-BTPSZBEZ5UQ4ITKVCP51/SWAK-demo-gif4.gif</image:loc>
      <image:title>Blog - Visualize your chemical space by connecting KNIME and TIBCO Spotfire®: Introduction to the SWAK - Make it stand out</image:title>
      <image:caption>Visualization of Malaria Dataset within the chemical space after some editing of the visualization.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1624662479972-XF20H1I7NXPXT1MUEEHS/Picture5.png</image:loc>
      <image:title>Blog - Visualize your chemical space by connecting KNIME and TIBCO Spotfire®: Introduction to the SWAK - Make it stand out</image:title>
      <image:caption>Visualization of Malaria Dataset (red) in comparison to Leishmaniasis Dataset (blue). Drugs targeting two different parasitic diseases do not necessarily cover the same part of the chemical space.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2021/6/25/discngine-centogene-a-collaboration-that-sparked-a-knime-success-story</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1624267303887-XQQHKBAT8HGU6LLLLT10/centogene.png</image:loc>
      <image:title>Blog - DISCNGINE &amp;amp; CENTOGENE: a collaboration that sparked a KNIME success story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1624267882166-IFK67EXJEOS90LP5I0BJ/logo+knime.png</image:loc>
      <image:title>Blog - DISCNGINE &amp;amp; CENTOGENE: a collaboration that sparked a KNIME success story - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2021/5/31/shifting-to-the-cloud-the-story-of-a-french-biotech-startup</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1621955139931-U24TD6TZPHCDSGW6FOHK/unsplash-image-to8o0bqOA6Q.jpg</image:loc>
      <image:title>Blog - Shifting to the Cloud: the story of a French biotech startup - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2021/5/17/five-major-obstacles-to-cloud-shift-for-life-science-rampd-and-how-to-overcome-them</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1620172500836-U6DPRKCFXYFH3ARY056O/LabVoice.png</image:loc>
      <image:title>Blog - Five major obstacles to Cloud shift for life science R&amp;amp;D - and how to overcome them...</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2021/3/22/structure-based-selectivity-optimization-of-protac-small-molecule-in-brd4crbn-complex</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1616417613491-97ZJ62ZTL32Y2A5JGR9K/chemical+structure+of+PROTAC+degrader+dBET23</image:loc>
      <image:title>Blog - Structure-based lead optimization of a PROTAC small-molecule in the BRD4-CRBN complex</image:title>
      <image:caption>Image 1: Chemical structure of dBET23 compound degrader, reference here</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1616417959629-0KMEYFXCP0X8843BBWFC/visual+inspection+of+a+pocket</image:loc>
      <image:title>Blog - Structure-based lead optimization of a PROTAC small-molecule in the BRD4-CRBN complex</image:title>
      <image:caption>Image 2: Visual inspection of an empty binding site subregion.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1616427210267-9ESNCB918R3717285XRJ/select+residues.png</image:loc>
      <image:title>Blog - Structure-based lead optimization of a PROTAC small-molecule in the BRD4-CRBN complex</image:title>
      <image:caption>Image 3: Selected residues for Subpocket Similarity Search.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1616427498680-UFSQ5H3PJIU934UNJT3T/ligand+residue+interaction+search+with+moieties+1.png</image:loc>
      <image:title>Blog - Structure-based lead optimization of a PROTAC small-molecule in the BRD4-CRBN complex</image:title>
      <image:caption>Image 4: Selected ligands from Subpocket Similarity search belonging to BRD4 which functional groups (depicted in green) occupy investigated binding site and could serve as a starting point for PROTAC modification.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1618902300069-TDB040RK7ZIUA6ISULQS/6mo7+for+blog.png</image:loc>
      <image:title>Blog - Structure-based lead optimization of a PROTAC small-molecule in the BRD4-CRBN complex</image:title>
      <image:caption>Image 5: Ligand belonging to BRD2 -functional group depicted in green considered for modification.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1618925587063-QB50774GSQI0IK1V4WAD/dBET23DOCKINGfinal.jpg</image:loc>
      <image:title>Blog - Structure-based lead optimization of a PROTAC small-molecule in the BRD4-CRBN complex</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1618943922303-IS4B097BTOW8QJRJL7OC/CHEM+DRAWfinal.png</image:loc>
      <image:title>Blog - Structure-based lead optimization of a PROTAC small-molecule in the BRD4-CRBN complex</image:title>
      <image:caption>Image 6 - Representation of the functional groups found through the Subpocket Similarity Search and added to the PROTAC warhead JQ1</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1618926899934-TKH5XTCFF40J8IZ0N1VW/3decision_3dviewer_image+%283%29.png</image:loc>
      <image:title>Blog - Structure-based lead optimization of a PROTAC small-molecule in the BRD4-CRBN complex</image:title>
      <image:caption>Image 7 - Docking results for compound A</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1618927846496-JTJ6FAKTVQJ17JJORKVM/butyl.jpg</image:loc>
      <image:title>Blog - Structure-based lead optimization of a PROTAC small-molecule in the BRD4-CRBN complex</image:title>
      <image:caption>Image 8 - Docking results for compound B</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1618927087637-ERS3A0MF33ZFOH3N1W8D/3F.png</image:loc>
      <image:title>Blog - Structure-based lead optimization of a PROTAC small-molecule in the BRD4-CRBN complex</image:title>
      <image:caption>Image 9 - Docking results for compound C</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1618928375776-TXFVDTS5DH3F0D4JISAK/result%25252Bfrom%25252BBRD2%25252BDB1%25252B-%25252Bpolar%25252Bgroup.jpg</image:loc>
      <image:title>Blog - Structure-based lead optimization of a PROTAC small-molecule in the BRD4-CRBN complex</image:title>
      <image:caption>Image 10 - Docking results for compound D</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2021/3/29/discngine-and-nanome-are-bringing-a-new-dimension-to-protein-structure-analysis</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1617031143327-P91XPJY8NIHFYXPXZ08N/Nanome_Logo.jpg</image:loc>
      <image:title>Blog - Discngine and Nanome are partnering up to enhance the structure-based drug design experience</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1617023443358-0T9TGSVV0D9A1PNNPODG/logo.PNG</image:loc>
      <image:title>Blog - Discngine and Nanome are partnering up to enhance the structure-based drug design experience</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2021/3/4/customer-success-story-an-innovative-way-of-organizing-data-how-can-3decision-improve-decision-making-process</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1615132614516-1K7EGZW4ZN6JXSNT407R/Profile+picture+of+Manuel+Cases+Thomas</image:loc>
      <image:title>Blog - An innovative way of organizing data: How can 3decision® improve decision-making process? [Customer Success Story]</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1615133834879-M1Q9IBKO767BB3LTF3KD/3decision+platform+for+structure+based+drug+design</image:loc>
      <image:title>Blog - An innovative way of organizing data: How can 3decision® improve decision-making process? [Customer Success Story]</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2021/2/10/starting-with-3decision-allosteric-pocket-detection-in-abl1-kinase</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1613048283266-Y51DSAKNU3A5WY5VLZT8/image+of+BCl-ABL1+kinase</image:loc>
      <image:title>Blog - Starting with 3decision®: Allosteric pocket detection in BCR-ABL1 kinase</image:title>
      <image:caption>BCR-ABL1 kinase (PDB:1IEP).</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1613053251402-H2X7I0U4ROVVZ3JN9RIF/Pocket+Explorer+map+in+3decision+showing+druggable+pockets</image:loc>
      <image:title>Blog - Starting with 3decision®: Allosteric pocket detection in BCR-ABL1 kinase</image:title>
      <image:caption>Representation of pocket explorer map with scored cavities (PDB:1FPU).</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1613053572740-EKFI4OJI8L840JUKVVG7/1iep5.pngPocket+Explorer+map+in+3decision+showing+druggable+pockets</image:loc>
      <image:title>Blog - Starting with 3decision®: Allosteric pocket detection in BCR-ABL1 kinase</image:title>
      <image:caption>Representation of pocket explorer map with scored cavities (PDB:1IEP).</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1613053777485-DL6GRY46342TWIUX79OB/identified+allosteric+binding+site+of+BCR-ABL1+kinase</image:loc>
      <image:title>Blog - Starting with 3decision®: Allosteric pocket detection in BCR-ABL1 kinase</image:title>
      <image:caption>Superposition of “druggable” pockets in the two analyzed structures.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1613054266416-H17RZ66BPJAQAPMWRRRS/Asciminib+in+the+allosteric+pocket+of+BCR-ABL1</image:loc>
      <image:title>Blog - Starting with 3decision®: Allosteric pocket detection in BCR-ABL1 kinase</image:title>
      <image:caption>The allosteric binding site of BCR-ABL1 with novel inhibitor Asciminib (PDB: 5MO4).</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/12/30/whats-new-in-3decision-20211</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1609323719027-GWLME0WYWCNOSH7NXLNX/051_EmailAlert1.png</image:loc>
      <image:title>Blog - What's new in 3decision® 2021.1?</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1610391147728-WG80O5E2UFG6WVKVNLWZ/3decision_HighlightMode.jpg</image:loc>
      <image:title>Blog - What's new in 3decision® 2021.1?</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1610117866736-U3A46Q8INIP6AAWMRBKX/ligand.1.jpg</image:loc>
      <image:title>Blog - What's new in 3decision® 2021.1?</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1610117684407-FRP4UUIRG1HGTM5RROT4/representation%2Bcard%2B5b7v.1.jpg</image:loc>
      <image:title>Blog - What's new in 3decision® 2021.1?</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1610118142147-48BJ3PEOP1FY7U6A2ZMW/workspace%2B5xfj11.jpg</image:loc>
      <image:title>Blog - What's new in 3decision® 2021.1?</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2021/2/4/we-are-ranked-in-the-top500-fastest-growing-companies-in-france-again-what-does-it-say-about-our-organizational-model</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1612480952083-N6S67G8GLT4N3DUZA2X0/champion-de-la-croissance-2021.png</image:loc>
      <image:title>Blog - We are ranked in the TOP 500 fastest-growing companies in France (again)! What does it say about our organizational model?</image:title>
      <image:caption>Source &amp; credit: Les Echos</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1612469470126-I3Y8ZGYSFSB98QJTFEST/composable-thinking.jpg</image:loc>
      <image:title>Blog - We are ranked in the TOP 500 fastest-growing companies in France (again)! What does it say about our organizational model?</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1612469616155-N8L2PS9GW1HCZR8B1KEO/composable-structure.jpg</image:loc>
      <image:title>Blog - We are ranked in the TOP 500 fastest-growing companies in France (again)! What does it say about our organizational model?</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1612469736950-1KW9OT1DG9KVDDRMIIAO/composable-technologies.jpg</image:loc>
      <image:title>Blog - We are ranked in the TOP 500 fastest-growing companies in France (again)! What does it say about our organizational model?</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1612469830634-VNEOGQOXJTZRB8TSMM50/discngine-composable-company.png</image:loc>
      <image:title>Blog - We are ranked in the TOP 500 fastest-growing companies in France (again)! What does it say about our organizational model?</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2021/1/18/spotting-differences-in-large-structure-collections</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1611043198566-8DIHDXG0DR2YONO1XY1S/Screenshot+2021-01-19+at+08.59.30.png</image:loc>
      <image:title>Blog - Spotting differences in large structure collections</image:title>
      <image:caption>On the left: chek1 kinase structure (5dls) superimposed to chek2 kinase structure (4bdc) with the default binding-site focused representation. On the right, the focused “difference” mode. All backbone is shown as thin ribbon, unless a major conformational change (or multiple mutations) occurs. All mutations or movements on the amino-acid level are shown as sticks.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1611049345692-JYKJJPLMWRSQXYPXR2X9/Screenshot+2021-01-19+at+10.39.30.png</image:loc>
      <image:title>Blog - Spotting differences in large structure collections</image:title>
      <image:caption>Example of showing all the differences on a larger ensemble of structures. All “major” movements get shown as lines or cartoon representation. The binding site is very stable and movements on the protein surface can be observed mainly on two locations.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2021/1/14/interview-what-are-the-challenges-for-medicinal-chemists-when-working-with-3d-structures</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1610989792826-MGJSPEUVOA7MIN9V1HPG/pic+for+thumbnail1.png</image:loc>
      <image:title>Blog - What are the challenges for medicinal chemists when working with 3D structures? - Interview</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1610622532103-SQ3HI11AZRTEZQWVA01H/George+Sheppard.jpg</image:loc>
      <image:title>Blog - What are the challenges for medicinal chemists when working with 3D structures? - Interview</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/12/17/how-to-speed-up-the-preparation-of-data-sets-for-sbdd-webinar-recap</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1608283823541-XQQWB97OPQ9QD5VKQM93/Capture.PNG</image:loc>
      <image:title>Blog - How to speed up the preparation of data sets for Structure-Based Drug Design? – Webinar Recap</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/12/8/getting-ready-for-alpha-fold-with-3decision</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1607445285685-6R9LD69C4822GBX0I0B5/top+image.png</image:loc>
      <image:title>Blog - Getting ready for AlphaFold with 3decision® - Getting ready for Alpha Fold with 3decision®</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1607446385890-FRF970WOWYSQM3JA4QT9/0002.jpg</image:loc>
      <image:title>Blog - Getting ready for AlphaFold with 3decision®</image:title>
      <image:caption>Current number of entries in RCSB PDB</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1607446428690-9T4VZECQRNOM8VLVNH0B/0001.jpg</image:loc>
      <image:title>Blog - Getting ready for AlphaFold with 3decision®</image:title>
      <image:caption>Structural data growth in the last 4 years: Computationally generated models (SWISS MODEL repository) compared with experimentally determined structures in PDB</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/10/16/delivery-management-at-discngine-the-key-to-make-an-it-project-a-success</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/9/25/should-medicinal-chemists-use-3d-molecular-modelling-tools</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1601681364925-94FMA8BUHSRFIF7HZBV2/image-asset.jpeg</image:loc>
      <image:title>Blog - Should medicinal chemists use 3D molecular modeling tools?</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1601682360138-KZONS34RDSG11BBF6TW7/image.jpg</image:loc>
      <image:title>Blog - Should medicinal chemists use 3D molecular modeling tools?</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1601682499354-MKOHEPT33BOZ1PN10TBS/image%2BAD.jpg</image:loc>
      <image:title>Blog - Should medicinal chemists use 3D molecular modeling tools?</image:title>
      <image:caption>Alexis Denis, PhD</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/7/3/interview-discngine-and-userstudio-share-their-point-of-view-on-their-collaboration-about-the-recent-improvement-of-3decisions-user-interface</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1596822052491-JVL2LSCKPTS1FC6IQ3ND/schema+process+UserStudio2.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
      <image:caption>The project was conducted in a 7 steps process over a few months period, as proposed by UserStudio, and it turned out very effective. (Credit image: Flaticon.com)</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1594851472533-FVSY1MJTSH1SICC8NWE6/Dng+Favicon.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1594851586275-GQP5Y1ILLWGLDFPCB4AV/User+studio.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1595531773677-I6Y3WN4NFHM0WZV2BQRZ/1.+User+Research.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1594851665300-FUUN4XRGPD7ZZ7MRI538/Dng+Favicon.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1594851848837-DKIMFO77MQD0BYH8VG2J/User+studio.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1594851937063-AZG7F0RUUOLECK373RGL/Dng+Favicon.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1595524439452-ANHHP1KVH9B3WGUHTCN7/2.+Esquisse+de+la+vision+cible+.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1594852055813-E4JGTZLL53KVQVM4LHVO/Dng+Favicon.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1594852098754-6RICEHTXME5MIURMSMHW/User+studio.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1595625834704-08NEY6NH4QIK00WEI69F/1.+MedChem+class+.JPG</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1595625828198-BK3LKO1YJL3SCKRN9ZAD/3.+Atelier+IMG_3732.jpg</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1595625835068-B9D9A2GIRYIUN2EVMJK3/3.+Atelier+.jpg</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1595625831849-5ELYCD2X2W57UTABWWTT/4.+Simplification+du+parcours+et+userflow.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1595626262372-5ECFTMBQZW5UJBGHBTBM/5.+Rendu+final+3.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1594852152812-X359LQI62T7L9B3OH26F/Dng+Favicon.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1594852183816-E28YQ8HIU7Z0277M608A/User+studio.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1595626771980-5EKMD2VCV1ZC8QMAE4TK/5.+Rendu+final+2.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1594852241865-VW2AWQU86PQKDX75FK07/Dng+Favicon.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1594852288176-3MS33XF6PFGON6AZFRV8/User+studio.png</image:loc>
      <image:title>Blog - Discngine &amp;amp; UserStudio: Uplifting User Experience in life science research applications</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/8/10/materialized-view-fast-refresh</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/6/29/get-ready-for-tibco-spotfire-1010-with-the-new-release-of-the-discngine-connector-54</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1593439413090-2CLZ0VMUDL1TLWPJEU6K/visu_components_custom_script.png</image:loc>
      <image:title>Blog - Get ready for TIBCO Spotfire 10.10 with the new release of the Discngine Connector 5.4</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1593439562908-D6BUT6XRMHOXIX6QZVCT/toolbarsmall.png</image:loc>
      <image:title>Blog - Get ready for TIBCO Spotfire 10.10 with the new release of the Discngine Connector 5.4</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/6/3/3decision-v2-discover-the-interaction-search</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/6/3/3decision-v2-discover-the-subpocket-search</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/6/3/3decision-v2-discover-the-new-ui</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1591172941474-17A9CEP2WB8RN2NOACBT/workspace_2020.06.1.jpg</image:loc>
      <image:title>Blog - 3decision® v2 – Discover the new UI</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/5/25/discngine-is-pleased-to-announce-a-partnership-with-i-stem-on-the-analysis-of-covid-19-tests</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1590451103226-AW0UH3U0DW44SAKJOUYM/I-Stem.jpg</image:loc>
      <image:title>Blog - Discngine is pleased to announce a partnership with I-Stem on the analysis of Covid-19 tests</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1590431954391-AK0L3F0JQ0GV2MQ1U06Q/screenshot.PNG</image:loc>
      <image:title>Blog - Discngine is pleased to announce a partnership with I-Stem on the analysis of Covid-19 tests</image:title>
      <image:caption>Example of a summary of I-Stem’s SARS-CoV-2 PCR analysis</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/discngine-and-labvoice-announce-strategic-partnership</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1589221720087-1HL2FVRNS2KLXDJ6Q9SH/labvoice_logo.png</image:loc>
      <image:title>Blog - Discngine and LabVoice Announce Strategic Partnership</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1589221852311-ZJ55XHJ3KCIR6AM1PW93/discngine_logo.png</image:loc>
      <image:title>Blog - Discngine and LabVoice Announce Strategic Partnership</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/4/10/when-simple-gets-simpler-pipeline-pilot-calculated-columns-for-tibco-spotfire</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1586522628800-3FB28CRUDZ0CRUD7CPN9/PPCC+Concept.png</image:loc>
      <image:title>Blog - When simple gets simpler! Pipeline Pilot Calculated Columns for TIBCO Spotfire</image:title>
      <image:caption>Pipeline Pilot Calculated Columns concept: Add and/or transform data columns with a Pipeline Pilot protocol</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1586524585324-B84IG97VWL1K9ZXT30X1/Connector+5.3+PPCC+v1.2+Gif.gif</image:loc>
      <image:title>Blog - When simple gets simpler! Pipeline Pilot Calculated Columns for TIBCO Spotfire</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1586524749777-6R21XX1U3MH859BZML9R/PPCC+Protocol+SMI.png</image:loc>
      <image:title>Blog - When simple gets simpler! Pipeline Pilot Calculated Columns for TIBCO Spotfire</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/4/2/sosei-heptares-selects-discngines-3decision-platform</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585828185783-Q3GB191X27GUF2GETCZE/AnnotationBrowser.PNG</image:loc>
      <image:title>Blog - Discngine announces that Sosei Heptares will use its 3decision® software to create an unprecedented structural GPCR chemogenomics platform</image:title>
      <image:caption>The Annotation Browser - an interactive layout for sequence and structure annotation analysis in 3decision®</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1570021831423-O9OS8PY7LJYNM1CEZ9BV/3decision.png</image:loc>
      <image:title>Blog - Discngine announces that Sosei Heptares will use its 3decision® software to create an unprecedented structural GPCR chemogenomics platform</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585827452516-F6ACT2909XKBRZUNVT4A/sosei-heptares.png</image:loc>
      <image:title>Blog - Discngine announces that Sosei Heptares will use its 3decision® software to create an unprecedented structural GPCR chemogenomics platform</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1586942700412-4DEFKDSM4M5P7VCKEKII/Discngine-Logo-Couleur-Big-Fond.png</image:loc>
      <image:title>Blog - Discngine announces that Sosei Heptares will use its 3decision® software to create an unprecedented structural GPCR chemogenomics platform</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/3/29/sars-cov-2-3-nsp1-a-detailed-analysis</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1586130172307-UZKCO9LAPZ5JGELQKC5N/Multiple_alignment_copy1.png</image:loc>
      <image:title>Blog - SARS-Cov-2 - part 3 - nsp1: A hopefully more detailed analysis of the cellular saboteur</image:title>
      <image:caption>Alignment of SARS-CoV-2 nsp1 and SARS-CoV nsp1. Alignment done with MUSCLE and image generated with JalView.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1586174301683-I0CU4S1DV8FY8CTHND00/image-asset.jpeg</image:loc>
      <image:title>Blog - SARS-Cov-2 - part 3 - nsp1: A hopefully more detailed analysis of the cellular saboteur</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585565722203-7KWSLKZGK0SFO34C20JV/Screen+Shot+2020-03-30+at+12.55.09.png</image:loc>
      <image:title>Blog - SARS-Cov-2 - part 3 - nsp1: A hopefully more detailed analysis of the cellular saboteur</image:title>
      <image:caption>Results from a systematic mutational study on SARS-CoV nsp1 reported here.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585651290547-77Y5QW06026JHCB0P0WQ/Screen+Shot+2020-03-31+at+09.41.19.png</image:loc>
      <image:title>Blog - SARS-Cov-2 - part 3 - nsp1: A hopefully more detailed analysis of the cellular saboteur</image:title>
      <image:caption>The the SARS-CoV nsp1 structure 2hsx opened in the Annotation Browser in 3decision. The focus lies on the annotations from the mutagenesis study mentioned in the table above.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1586103173324-1YM6FTQ0TZXSMHB0VRFE/Screen+Shot+2020-04-05+at+18.12.01.png</image:loc>
      <image:title>Blog - SARS-Cov-2 - part 3 - nsp1: A hopefully more detailed analysis of the cellular saboteur</image:title>
      <image:caption>Unique hit obtained via hhpred using “NKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG” (C-ter of nsp1 from SARS-CoV-2) as query.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1586118229133-5SOJUC36VQOLIOT0LCOM/Screen+Shot+2020-04-05+at+22.23.09.png</image:loc>
      <image:title>Blog - SARS-Cov-2 - part 3 - nsp1: A hopefully more detailed analysis of the cellular saboteur</image:title>
      <image:caption>Structure of the yeast RNA Exosome complex (source). Spot the Rrp45/46 complex in the middle (yellow/red).</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1586118897788-M16WF1QVQG7L9ZHSOSKW/3decision_3dviewer_image.png</image:loc>
      <image:title>Blog - SARS-Cov-2 - part 3 - nsp1: A hopefully more detailed analysis of the cellular saboteur</image:title>
      <image:caption>Overview of the interaction between Rrp45 (green) and Rrp46 (orange). Open the same view in 3decision here. Based on RCSB structure 2nn6</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/3/27/sars-cov-2-2-from-the-viral-genome-towards-protein-structures</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585385919201-H93SZAC84NZ2D9WLWQVP/nCoV_genome.png</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
      <image:caption>The SARS-CoV-2 genome structure as available on viralzone.expasy.org</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585385985607-QE39EG2G6E8EMLTP1HFM/Screen+Shot+2020-03-28+at+09.55.44.png</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
      <image:caption>Image extracted from a review on coronavirus genome structures from early 2020.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585392393345-QBG4EPY9L65XGNWR7B9T/Screen+Shot+2020-03-28+at+11.46.18.png</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
      <image:caption>Image taken from here</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585403878033-BM90TLDQVRRNTW8XXHUD/Schematic-of-the-replication-cycle-of-Middle-East-respiratory-syndrome-coronavirus+%281%29.png</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
      <image:caption>Taken from a review on the previous MERS-CoV outbreak. Apart from a few details, the current SARS-CoV-2 acts rather similarly.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585394236560-OA8K3E2XZQVZMZ8QHOOI/Screen+Shot+2020-03-28+at+12.16.29.png</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
      <image:caption>An extract of the non structural proteins (nsp) annotations on the official Uniprot entry of SARS-CoV2’s polyprotein pp1ab. Visualisation from 3decision.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585725060255-HW78L6GMDC290TGSZ3Z0/Screen+Shot+2020-04-01+at+09.10.23.png</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
      <image:caption>Interaction map from https://www.biorxiv.org/content/10.1101/2020.03.22.002386v3</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585486453950-21ZY5A3FVM6RWO1SVBD0/Favipiravir</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585486550605-TLCH2BB1XONMMUXXFKK6/Ribavirin</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585486830560-GJEJWIFM3IML6FDUK6LL/Remdesivir</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585487236200-P05ODAU4YOOQJN0BS9QC/Galidesivir</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585487477502-99956BL9GNEVR7JPD1FS/Griffithsin</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585487571558-1ZA3FIMGQ53HNAYITI79/Chloroquine</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585487965367-AW823IIUO12T9SA5V9FW/Nitazoxanide</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585488058555-04RIVSHANJQEBQPUCG45/Disulfiram</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585488229759-1C7MGQ1R42S8K43WHEZI/Lopinavir+%2F+Ritonavir</image:loc>
      <image:title>Blog - SARS-CoV-2 - part 2 - From the viral genome to protein structures</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/3/27/sars-cov-2-1-thriving-for-a-systematic-target-and-hit-id-effort</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/2/26/molecular-graphs-as-input-for-neural-networks</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1582744580609-DBCM0IHWU8NXHRFDM22K/blog.png</image:loc>
      <image:title>Blog - Molecular Graphs as input for Neural Networks</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1582745079092-D0XV6YZ0KFA81SEZB45H/blog+2.png</image:loc>
      <image:title>Blog - Molecular Graphs as input for Neural Networks</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1582745113361-9B5LISJ81L0VY4HT7FXJ/Blog+3.png</image:loc>
      <image:title>Blog - Molecular Graphs as input for Neural Networks</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/2/18/creating-acollaborative-platform-for-structure-based-drug-discovery</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1582066804273-HRYWSQO86P2IYL3BBACC/collaboration.jpg</image:loc>
      <image:title>Blog - Discover 3decision® - Part 2: Creating a collaborative platform for Structure-Based Drug Discovery</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1582066958335-Y8NPZTKL86KDJB4XX96Q/3decision+interface.jpg</image:loc>
      <image:title>Blog - Discover 3decision® - Part 2: Creating a collaborative platform for Structure-Based Drug Discovery</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1582067021462-OO3Z0H2315CO2KBZDORF/lead+op+loop.png</image:loc>
      <image:title>Blog - Discover 3decision® - Part 2: Creating a collaborative platform for Structure-Based Drug Discovery</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1582067166617-OR3QX6W0HUL6GJ78T5CT/bioIT%2Baward.jpg</image:loc>
      <image:title>Blog - Discover 3decision® - Part 2: Creating a collaborative platform for Structure-Based Drug Discovery</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019-ncov-structurally-speaking-part-2</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581379307970-WZS9M31364LGLQDLK3ZS/image+1.png</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking - part II</image:title>
      <image:caption>Figure 1. The peptide-like inhibitor N3</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581379350879-GOEQLHMTIUSXSSD5XO22/image+2.png</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking - part II</image:title>
      <image:caption>Figure 2. the newly resolved structure of the 2019-nCoV main protease in complex with a peptide-like inhibitor (PDB 6lu7).</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581379376753-IL4JTPLX3ZFQG8762BMI/image+3.png</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking - part II</image:title>
      <image:caption>Figure 3. The 3decision Sequence Viewer. To the left: Sequence alignment of the 2019-nCoV and SARS-nCoV orf1ab polyprotein sequences. Only the residues in the active site of the Mpro are shown. Differences compared to the reference sequence (here: 2019-nCoV) are shown by one-letter codes. Only one residue differs – S3309A. To the right: X-ray structure of the 2019-nCoV Mpro (6lu7) with the residue S3309 highlighted.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581379407021-BK11LY86N5O92KZNXK7E/image+4.png</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking - part II</image:title>
      <image:caption>Figure 4. Overlay of three 2019-nCoV Mpro structures: the experimentally resolved structure (PDB 6lu7) in green, Innophore’s homology model (QHD LP1) in orange, and the Zhang Lab’s homology model in blue.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581379464449-8YSPL899LUS015K2AGDB/image+5.png</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking - part II</image:title>
      <image:caption>Figure 5. Overlay of the HIV-1 protease structure (PDB 4l1a) (protein chains colored in orange and purple) and the Innophore LP1 model of the 2019-nCoV protease (in blue). The overlay is based on the ligand-ligand superposition.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581379500108-QI5GT8U8KI9SD6JF574X/image+6.png</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking - part II</image:title>
      <image:caption>Figure 6. The drug Baricitinib</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581379564998-H0B01ZXU2PXZPKPB5X8Q/image+7.png</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking - part II</image:title>
      <image:caption>Figure 7. Structure overlay of BMP2K bound to Baricitinib (PDB 4w9x) in green, and AAK1 bound to an inhibitor in blue (PDB 5l4q). Both ligands are bound to the hinge.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581379613369-10LZ77N8Z4Q9FVD849HP/image+8.png</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking - part II</image:title>
      <image:caption>Figure 8. The 3decision Sequence Viewer. To the left: Sequence alignment of the BMP2K, AAK1 and GAK Mpro sequences. Differences compared to the reference sequence (here: BMP2K) are shown by one-letter codes. Ligand-protein interactions are mapped onto the sequence alignment and colored by type (green=hydrophobic, red=hydrogen bond, purple= water bridge, pink=salt bridge). Each line corresponds to a unique ligand. To the right: Structure overlay of BMP2K bound to Baricitinib (PDB 4w9x) in green, and AAK1 in blue (PDB 5l4q). The BMP2K protein chain, and the AAK1 ligand are hidden. BMP2K’s Ser63 is selected.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581379652636-F3EH1MZ24WXO3J8KUQPO/image+9.png</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking - part II</image:title>
      <image:caption>Figure 9. A model of an AAK1-Baricitinib complex.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019-ncov-structurally-speaking</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581377814750-ENH1E7BQ8EI57JPZIX3A/coronavirus+replication.png</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking</image:title>
      <image:caption>Image credit: Crenim at English Wikipedia, CC BY-SA 3.0 / Wikimedia Commons</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581378008374-BN1KKI9NL0DUTAM5NQG3/coronavirus-structure.jpg</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking</image:title>
      <image:caption>Image credit: Wikimedia Commons</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581378086914-VD58B3I6YQM5QYWDZP1H/treatments.png</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1581378128132-3VKQOR9QQHC3VHU78OX2/3decision+selectivity+analysis.png</image:loc>
      <image:title>Blog - 2019-nCov, structurally speaking</image:title>
      <image:caption>A selectivity analysis in the 3decision® user interface</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/1/22/whats-new-in-3decision-2020-1</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1580221270878-PDSDRZL5R58WATFIXS4Q/Tversky.png</image:loc>
      <image:title>Blog - What's New in 3decision® 2020.1?</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1579692129047-F9TKH13PVF5OA5PV4HT3/BI2536+in+the+3decision+Workspace</image:loc>
      <image:title>Blog - What's New in 3decision® 2020.1?</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1580221238228-8KMJ76AE81I0EVJJVHAI/Project+Refernce+Structure</image:loc>
      <image:title>Blog - What's New in 3decision® 2020.1?</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2020/1/20/the-growing-mountain-of-protein-structural-data-challenges-and-opportunities-in-structure-based-drug-discovery-sbdd</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1576018616404-GOQKM5H1Z3Y4RDJ4RQBP/proteine.jpg</image:loc>
      <image:title>Blog - Discover 3decision®  - Part 1: The Growing Mountain of Protein Structural Data</image:title>
      <image:caption>Molecular representation of a ligand-binding-site.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1579521543817-BIOHXZG827D5R8VX8XIH/RCSB+PDB+statistics</image:loc>
      <image:title>Blog - Discover 3decision®  - Part 1: The Growing Mountain of Protein Structural Data</image:title>
      <image:caption>The overall growth of released PDB structures in the last 30 years. (Source: https://www.rcsb.org)</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1579522365029-KL6TJF4060J7X86BXWLD/3decision_transparent.png</image:loc>
      <image:title>Blog - Discover 3decision®  - Part 1: The Growing Mountain of Protein Structural Data</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019/11/15/benefit-from-tibco-spotfire-server-new-rest-apis-with-the-new-release-52-our-the-discngine-connector</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1573824937615-RKDD1LN5YPLVMV8SHZW3/Connector+5.2+Automation.png</image:loc>
      <image:title>Blog - Benefit from TIBCO Spotfire Server REST APIs with the new release 5.2 of the Discngine Connector</image:title>
      <image:caption>Automation Services Job execution from within Pipeline Pilot</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1573826494369-EH25MGMKFJQI18EWF9AT/Connector+5.2+Library+Upload.png</image:loc>
      <image:title>Blog - Benefit from TIBCO Spotfire Server REST APIs with the new release 5.2 of the Discngine Connector</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1573826950346-MGS6FRP0PXPJUHOUWAYE/Connector+5.2+Swapp.png</image:loc>
      <image:title>Blog - Benefit from TIBCO Spotfire Server REST APIs with the new release 5.2 of the Discngine Connector</image:title>
      <image:caption>Spotfire Web Application for Pipeline Pilot (S.W.A.P.P)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019/8/30/lundbeck-selects-discngines-3decision-platform-to-leverage-complex-protein-ligand-3d-structure-data-in-the-discovery-of-new-treatments-of-brain-diseases</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1570022150885-V60OBE8PX36ZWPNV2F3Y/SequenceExplorer.PNG</image:loc>
      <image:title>Blog - Lundbeck selects Discngine’s 3decision® platform</image:title>
      <image:caption>One of the structural analytics tools in 3decision® - the sequence explorer.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1586943140274-9F12ENH9EMW2BXRJWW4W/Discngine-Logo-Couleur-Big-Fond.png</image:loc>
      <image:title>Blog - Lundbeck selects Discngine’s 3decision® platform</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1570022407030-SELBFTRS13E9CQKXNNDG/LUNDBECK-logo-RGB.jpg</image:loc>
      <image:title>Blog - Lundbeck selects Discngine’s 3decision® platform</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1570021831423-O9OS8PY7LJYNM1CEZ9BV/3decision.png</image:loc>
      <image:title>Blog - Lundbeck selects Discngine’s 3decision® platform</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019/7/25/new-version-51-production-of-our-connector-for-spotfire-and-pipeline-pilot</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1564045266111-CDWGJ925DXQAWSAN15H4/Connector+5.1+Modules.png</image:loc>
      <image:title>Blog - New version 5.1 Production of our Connector for Spotfire and Pipeline Pilot</image:title>
      <image:caption>Discngine Connector v5.1 Modules</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019/6/3/mockuping-using-adobe-xd-for-scientific-web-app-development</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561585885079-CAU0W07V1OO1I2QCDPE6/Screenshot+of+3decision%27s+Sequence+Explorer+Layout</image:loc>
      <image:title>Blog - Using Adobe XD for Scientific Web app development - do your mockups</image:title>
      <image:caption>3decision’s sequence explorer layout - just as an example</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561584871816-TSMX2N3O5XQHPTMX6LP9/Screen+Shot+2019-06-26+at+23.32.26.png</image:loc>
      <image:title>Blog - Using Adobe XD for Scientific Web app development - do your mockups - Design mode</image:title>
      <image:caption>Design screens, make reusable components</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561584923314-L9D6XHOLSBS9L4QF0DZH/Screen+Shot+2019-06-26+at+23.35.11.png</image:loc>
      <image:title>Blog - Using Adobe XD for Scientific Web app development - do your mockups - Create Workflows</image:title>
      <image:caption>Connect screens or elements on different screens to create user workflows</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561584868980-78UMZ62GC4DEELIM0HZ7/Screen+Shot+2019-06-26+at+23.33.06.png</image:loc>
      <image:title>Blog - Using Adobe XD for Scientific Web app development - do your mockups - Share</image:title>
      <image:caption>Share with your end-users or with other developers</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561584970845-1WMPR2A8LCE0F2D2CBFO/Screen+Shot+2019-06-26+at+23.35.51.png</image:loc>
      <image:title>Blog - Using Adobe XD for Scientific Web app development - do your mockups - Simulation mode</image:title>
      <image:caption>Quickly simulate your workflow and record screens and voice to a video</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019/6/25/discngine-turns-15</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561553907762-EQT9R3FF8RIJ4YGATSZ9/20190619204805_IMG_1292+%281%29.JPG</image:loc>
      <image:title>Blog - Discngine turns 15!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561555077208-KGKAXZPUIHQQU65VRG6R/DNG161.JPG</image:loc>
      <image:title>Blog - Discngine turns 15!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561554275753-I5QWAL5H8GFCDTX74H64/DNG158.JPG</image:loc>
      <image:title>Blog - Discngine turns 15!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561555163559-E42LUUH4RLN3APAI1D7W/DNG156.JPG</image:loc>
      <image:title>Blog - Discngine turns 15!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561554910763-F9LVK3ERFVU7FOC9SZBY/DNG185.JPG</image:loc>
      <image:title>Blog - Discngine turns 15!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561554429676-9CCXAWUVK91CZQ9V5DQE/DNG183.JPG</image:loc>
      <image:title>Blog - Discngine turns 15!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561554150183-G5H8VSVDG6PE85VP41VC/DNG119.JPG</image:loc>
      <image:title>Blog - Discngine turns 15!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561554200408-6H61W6E93VBYVI8Y3ZNX/DNG124.JPG</image:loc>
      <image:title>Blog - Discngine turns 15!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561555379026-MPFWS9CH8G55SDDP8LUE/DNG060.JPG</image:loc>
      <image:title>Blog - Discngine turns 15!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1561554026757-9OO35ACTFKPIT6JZKGPF/DNG045.JPG</image:loc>
      <image:title>Blog - Discngine turns 15!</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019/6/12/openforcefield-040-parametrization-tests-on-xchem-and-rcsb-data</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1560379691062-SK6E1YTYMBIPR8E6AEXR/Screen+Shot+2019-06-13+at+00.47.33.png</image:loc>
      <image:title>Blog - OpenForcefield 0.4.0 parametrization tests on XChem Data</image:title>
      <image:caption>Browsing the results in the awesome ligand browser in 3decision ;) - sorry no impartiality here</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019/6/6/tethered-minimization-of-small-molecules-with-rdkit-towards-tethered-docking-on-proteins-with-rdock</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1559854561304-HWCAOV3LQ3B3OLAEP6XY/pu8.png</image:loc>
      <image:title>Blog - Tethered minimization of small molecules with RDKit</image:title>
      <image:caption>PU8 ligand in RCSB PDB structure 1uyd</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1559854883383-HP11LYASRV3DB7OJ53UX/hsp90_mols.png</image:loc>
      <image:title>Blog - Tethered minimization of small molecules with RDKit</image:title>
      <image:caption>Compounds we’d like to dock</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1559856315654-4JAC8QZBX4A9M7QKL1OP/Screen+Shot+2019-06-06+at+23.24.32.png</image:loc>
      <image:title>Blog - Tethered minimization of small molecules with RDKit</image:title>
      <image:caption>Now we have the TETHERED ATOMS in the output SD file - ready for rdock</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1559856414202-0KZVFUBS0LMTMI9PE3C2/3decision_3dviewer_image.png</image:loc>
      <image:title>Blog - Tethered minimization of small molecules with RDKit</image:title>
      <image:caption>Final aligned and minimized molecules - all adenins are perfectly aligned and even other parts of the molecule are as well, if the MCS was bigger than the adenine fragment.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1559856723920-8RFO06M6BVL3RHFRFRFV/Screen+Shot+2019-06-06+at+23.31.36.png</image:loc>
      <image:title>Blog - Tethered minimization of small molecules with RDKit</image:title>
      <image:caption>Excerpt from the rdock documentation</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019/5/25/building-the-vmd-molfile-plugin-from-source-code</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1558741352346-EAGCNOMCG3W0FWCRIBX4/Final+compiled+molfile+plugin</image:loc>
      <image:title>Blog - Building the VMD molfile plugin</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1558901463697-6CHW038SAD48URI9I38X/Screen+Shot+2019-05-26+at+22.10.41.png</image:loc>
      <image:title>Blog - Building the VMD molfile plugin</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019/3/29/discngine-and-abbvie-winner-of-the-innovative-practices-award-at-bio-it-2019</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1556130197537-UG84HNDUQZB5P89OB94L/BIT+Innovative+Practics-Award-WINNER.jpg</image:loc>
      <image:title>Blog - Discngine and AbbVie, winners of the Innovative Practices Award at Bio-IT 2019!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1556130917402-189KRIYL1S9OOW14RGAG/3decision-user-interface.PNG</image:loc>
      <image:title>Blog - Discngine and AbbVie, winners of the Innovative Practices Award at Bio-IT 2019!</image:title>
      <image:caption>re</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/should-you-invalidate-wells-when-performing-a-qualification-of-your-liquid-handling-process</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d8c466e6-3c38-4d56-ba08-ab59f9df7f60/well%2Bselection%2Bfor%2Binvalidation.png</image:loc>
      <image:title>Blog - Should you invalidate wells when performing a qualification of your liquid handling process? - Make it stand out</image:title>
      <image:caption>Figure 1 - Well selection for invalidation from a Z-Score distribution (Discngine Qualification)</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/servier-chose-qualification-to-qualify-its-automated-laboratory-equipments</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2095c0a9-b427-440f-b8f9-23abe508ebc6/LogoQualification_small_website.png</image:loc>
      <image:title>Blog - Servier chose Qualification to qualify its Automated Laboratory Equipments - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1544030495200-VB014WIYIDHVXMVLX25A/servier2.png</image:loc>
      <image:title>Blog - Servier chose Qualification to qualify its Automated Laboratory Equipments - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019/3/28/discngine-will-be-in-boston-for-the-bio-it-2019-conference</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1554307892911-1CSMVYXOI9YJDB4O4PXT/Flyer_BIO_IT2_01_HD+web.jpg</image:loc>
      <image:title>Blog - Discngine will be in Boston for the Bio-IT 2019 conference!</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019/3/29/discngine-is-certified-iso-42000</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2019/3/20/discngine-will-participate-in-the-forum-labo-paris-event</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1553037749713-3IWV8KTC73E5AJYBFLC0/forum+labo.jpg</image:loc>
      <image:title>Blog - Discngine will exhibit at the Forum Labo Paris event!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1553037954615-RR517NRU96P3EZ4YOPGS/BIOVIA_Logo.jpg</image:loc>
      <image:title>Blog - Discngine will exhibit at the Forum Labo Paris event!</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2024/9/27/-interview-audrey-picy-and-sbastien-issindou-from-evotec-are-talking-about-liquid-handling-qualification-processes</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1544029666626-BQAQBIFJW99NXBEYYYWL/Evotec.png</image:loc>
      <image:title>Blog -  Interview: Audrey Picy and Sébastien Issindou from Evotec are talking about Liquid Handling qualification processes! - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/discnginequalification-first-webinar</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1539593765930-HJBJV3E5KTBTAX9429FP/How-to-evaluate-and-track-the-performance-of-your-liquid-handling-processes.png</image:loc>
      <image:title>Blog - Discngine Qualification launches its First Webinar!</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/why-having-a-qualification-history-of-your-automated-liquid-handling-processes-is-better-for-your-lab</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1727387786011-BTG9UZWBNIXG3GNULZK9/AdobeStock_140513404.jpeg</image:loc>
      <image:title>Blog - Why having a Qualification history of your automated liquid handling processes is better for your lab? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/880b24af-1683-441d-a94d-6f7b0fe94259/control%2Bchart.png</image:loc>
      <image:title>Blog - Why having a Qualification history of your automated liquid handling processes is better for your lab? - Make it stand out</image:title>
      <image:caption>A Control Chart Model</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2018/8/8/discngine-qualification-product-award-finalist-at-slas-europe-conference-2018</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2018/4/9/were-launching-our-very-first-webinar-</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1523268314197-SV6ZIS6J9U7A43JZZGCU/Discngine+-+3decision+-+invitation+webinar+201804.png</image:loc>
      <image:title>Blog - We're launching our very first Webinar!</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2018/3/23/optimized-storage-and-querying-for-matched-molecular-pairs-the-mmp-database</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1521824034546-8GEBBSYXN9PQQL70LMOT/image-asset.png</image:loc>
      <image:title>Blog - Optimized Storage and Querying for Matched Molecular Pairs:  The MMP Database</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1521824089132-C607KNC501YPLOBXKGWT/image-asset.png</image:loc>
      <image:title>Blog - Optimized Storage and Querying for Matched Molecular Pairs:  The MMP Database</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1521824195179-KM925ZSTTDKM4K47GW0Y/image-asset.png</image:loc>
      <image:title>Blog - Optimized Storage and Querying for Matched Molecular Pairs:  The MMP Database</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1521824299777-98T5DM9216DHL9FXZJSO/mmp6.png</image:loc>
      <image:title>Blog - Optimized Storage and Querying for Matched Molecular Pairs:  The MMP Database</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1521823482246-1VRZZDFMLK0X46OCCO1S/mmp1.png</image:loc>
      <image:title>Blog - Optimized Storage and Querying for Matched Molecular Pairs:  The MMP Database</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1521823520220-LWDSZXLJ4MF6LK888L11/mmp2.png</image:loc>
      <image:title>Blog - Optimized Storage and Querying for Matched Molecular Pairs:  The MMP Database</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2018/1/17/the-newbie-backlog-how-we-welcome-our-new-co-workers</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1516204173544-BP5V7FXPMB4UUDM54XKU/%22Remember+the+future%22+to+improve+your+organization</image:loc>
      <image:title>Blog - The Mentee Backlog: How we welcome our new co-workers.</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1516204114178-HCIN17QZXS46LGDGNE7N/newbie+backlog+for+new+co-workers</image:loc>
      <image:title>Blog - The Mentee Backlog: How we welcome our new co-workers.</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1516203815270-B9WHVFPPUPLGFPNMYERD/Onboarding+Guru</image:loc>
      <image:title>Blog - The Mentee Backlog: How we welcome our new co-workers.</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2017/12/14/we-are-starting-a-slack-community-for-our-clients-heres-why</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1513248384465-JASDXNJOHX0RGGY0GGHX/slack_banner.png</image:loc>
      <image:title>Blog - We're starting a Slack community for our customers! Here's why.</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1513601112358-MVTIVOQS471EPXJUIGIS/Slack_signup.png</image:loc>
      <image:title>Blog - We're starting a Slack community for our customers! Here's why.</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1513255729062-CRKG7Y4AWLF9VJJ1A89U/WHAT-IS-SLACK-Slack-overview-1024x690.png</image:loc>
      <image:title>Blog - We're starting a Slack community for our customers! Here's why.</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1513609026701-6UGJ3MYSWIFOI7MLHDQ5/dngAll.jpg</image:loc>
      <image:title>Blog - We're starting a Slack community for our customers! Here's why.</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1513601001604-HRW882ISXK61LPIF5P36/Slack_signup.png</image:loc>
      <image:title>Blog - We're starting a Slack community for our customers! Here's why.</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1513773665098-LXYODCREDOCMBIMNMN9G/cdv_dng_2018.jpg</image:loc>
      <image:title>Blog - We're starting a Slack community for our customers! Here's why.</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2017/12/11/discngine-announces-series-a-financing-round-from-extens</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2017/11/3/meet-us-for-the-elrigfr-event-in-monaco-november-27-28th</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1509694929296-NQW3VF70VJEAKT74KV4E/qualification.PNG</image:loc>
      <image:title>Blog - Meet us for the next ElrigFR event in Monaco, November 27-28th</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1509695149421-JY4F3TD3YC1UDT0BZFKT/elrig.png</image:loc>
      <image:title>Blog - Meet us for the next ElrigFR event in Monaco, November 27-28th</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2017/9/21/pipeline-pilot-in-docker-speeding-up-complex-deployments</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1506982624435-DE4K6XTSQR7U3LXJV2AP/dockerPP.png</image:loc>
      <image:title>Blog - Pipeline Pilot in Docker - speeding up complex deployments</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2017/7/4/do-more-with-spotfire-and-pipeline-pilot-the-discngine-connector-v40-is-out</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1499186289707-PZMTTSWGE2DB8K7Q2YTS/automation2.png</image:loc>
      <image:title>Blog - Do more with Spotfire and Pipeline Pilot: the Discngine Connector v4.0 is out! - Spotfire Automation components</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1499186139390-G93QA7EPK6MC8FJ6WJMO/Any+Spotfire+client%2C+any+science</image:loc>
      <image:title>Blog - Do more with Spotfire and Pipeline Pilot: the Discngine Connector v4.0 is out!</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2017/6/1/join-us-in-london-for-the-2017-european-biovia-forum</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1496309869523-V62BVH3590WETP52Y3BR/image-asset.png</image:loc>
      <image:title>Blog - Join us in London for the 2017 European BIOVIA Forum</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2017/5/11/visit-us-at-bioit-world-2017-conference-expo-in-boston</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1494600994265-TJMZY5KYJL4HNQK3J8XH/image-asset.png</image:loc>
      <image:title>Blog - Visit us at BioIT World 2017 Conference &amp;amp; Expo in Boston</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2017/3/22/forum-labo-paris-2017</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1490201748731-0YE6O0BG6ESEJ2QDKSOD/Pipetting+Heads+Qualification+Survey+Results.png</image:loc>
      <image:title>Blog - Forum Labo Paris 2017</image:title>
      <image:caption>Click for details...</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1490201690287-G6Y551SGB9LHR9VVO30K/image-asset.jpeg</image:loc>
      <image:title>Blog - Forum Labo Paris 2017</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2017/1/9/happy-new-year-to-everybody-from-paris</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1483976347402-4H5ULPO95T9FJ20XPZN7/Greeting+Card+2017</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1765275149987-PZ6ST08F3XGY6OV1JKWD/image-asset.png</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1765275149987-PZ6ST08F3XGY6OV1JKWD/Discngine-Voeux2026.png</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2026 (Copy)</image:title>
      <image:caption>2026</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1736876869952-KAZPG2SKMU7HUTXJPKBG/Discngine-BestWishes2025-Finale.png</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2025 (Copy)</image:title>
      <image:caption>2025</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1701881617889-QWCT6FCQTK60JTASDX8Y/image-asset.png</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2024 (Copy)</image:title>
      <image:caption>2024</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1671040307999-GUW3NGOQM6IW3GOZI4IZ/image-asset.png</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2023 (Copy)</image:title>
      <image:caption>2023</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1639589267748-4V6ABJBF2BEM598OTZ97/Discngine+-+voeux+2022.png</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2022 (Copy)</image:title>
      <image:caption>2022</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1606472227137-5RUDRPNXTG3RKJOQ021R/image-asset.jpeg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2021 (Copy)</image:title>
      <image:caption>2021</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1576112531211-DM1SJTQP1GY0NKL2NJ1M/Discngine-voeux-2020.jpg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2020 (Copy)</image:title>
      <image:caption>2020 Happy New Year 2020! Discngine wishes you success in all your future endeavors!</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1545145175810-M3HRHRJ4N10C2O1KCSND/cdv_dng_2019.jpg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2019 (Copy)</image:title>
      <image:caption>2019 Discngine wishes you the best for the new year coming ahead!</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1513758917348-DPLIJ6RQQO4VRUTFLARM/cdv_dng_2018.jpg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2018 (Copy)</image:title>
      <image:caption>2018</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1483979347890-2VU3LXWQW3IM6NXTWE69/cdv_dng_2017.png</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2017 (Copy)</image:title>
      <image:caption>2017</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1452535143515-0KDUVGIP5B0S016ARMIO/image-asset.png</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2016 (Copy)</image:title>
      <image:caption>2016</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1420472861128-RMN9GVGQWDIC6K68PRA3/image-asset.jpeg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2015 (Copy)</image:title>
      <image:caption>2015</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1388064073895-0YG2SNZYCRTM8I5D9V20/Discngine-2---2014.jpg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2014 (Copy)</image:title>
      <image:caption>2014</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380329614-XLEUCRUPPGFQRKRG3N92/discngine+-+2013+-+finale-01.jpg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2013 (Copy)</image:title>
      <image:caption>2013</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380261311-AVWJJGADD5MGIJVVQOMZ/cdv_dng_2012.jpg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2012 (Copy)</image:title>
      <image:caption>2012</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380258076-7965VIZXMW3H2ICW3U12/cdv_dng_2011.jpg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2011 (Copy)</image:title>
      <image:caption>2011</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380253611-3J32TMGSTF4KB4KTCBR7/cdv_dng_2010.png</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2010 (Copy)</image:title>
      <image:caption>2010</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380246327-X3FQ8LX23OW8HXNDEGN8/cdv_dng_2009.jpg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2009 (Copy)</image:title>
      <image:caption>2009</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380237365-PKEDH3R39DZ46GI1BK2H/cdv_dng_2008.jpg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2008 (Copy)</image:title>
      <image:caption>2008</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380242643-EDR7L7RD1LUWVAQU9VFF/cdv_dng_2007.jpg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2007 (Copy)</image:title>
      <image:caption>2007</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380229481-VCFIP497MUQGHGNU7VXG/cdv_dng_2006.png</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2006 (Copy)</image:title>
      <image:caption>2006</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380224773-MZK50C8FQ02XM2Z2V1DH/cdv_dng_2005.jpg</image:loc>
      <image:title>Blog - Happy New Year to everybody! Best wishes from Paris! - 2005 (Copy)</image:title>
      <image:caption>2005</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/10/28/spice-up-your-tibco-spotfire-documents-with-the-new-release-34-of-the-pipeline-pilot-connector</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1477669589151-SW8FNZB5QFMECUWCG512/image-asset.png</image:loc>
      <image:title>Blog - Spice up your TIBCO Spotfire documents with the new release 3.4 of the Pipeline Pilot Connector</image:title>
      <image:caption>Combine Pipeline Pilot report elements and Spotfire Visual Analytics elements in a single page (requires Spotfire 7.5+)</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1477669831374-7DGW72X723AO3HN3JBYA/image-asset.png</image:loc>
      <image:title>Blog - Spice up your TIBCO Spotfire documents with the new release 3.4 of the Pipeline Pilot Connector</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1477670190375-VH4X575PTYJUD8LFU46E/image-asset.jpeg</image:loc>
      <image:title>Blog - Spice up your TIBCO Spotfire documents with the new release 3.4 of the Pipeline Pilot Connector</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/10/24/discngine-sponsor-of-the-upcoming-german-conference-on-chemoinformatics</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1477307612854-AXDBB3YIETIJPGHH40X9/image-asset.png</image:loc>
      <image:title>Blog - Discngine - Sponsor of the upcoming German Conference on Chemoinformatics</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/7/19/4th-discngine-internal-agile-development-summit</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1468922919455-4VIY8O6AF36GBWRGNUK1/image-asset.jpeg</image:loc>
      <image:title>Blog - 4th Discngine internal Agile development summit</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1468921767964-Z9O0V4BWXC3IOXPTGKP0/image-asset.jpeg</image:loc>
      <image:title>Blog - 4th Discngine internal Agile development summit</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/6/28/discngine-sponsor-of-the-chemoinformatics-summer-school-2016-in-strasbourg</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1467123440112-81TDBXRCYAJHG7R9JG8I/image-asset.png</image:loc>
      <image:title>Blog - Discngine sponsor of the Chemoinformatics Summer School 2016 in Strasbourg</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/5/31/discngine-sponsor-of-the-european-biovia-forum-2016</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1464698415114-8Y8G601BCFG4KDCO8BFN/image-asset.png</image:loc>
      <image:title>Blog - Discngine sponsor of the European BIOVIA Forum 2016</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/5/18/meet-us-on-booth-1-at-the-biovia-event-in-boston-on-may-23rd-to-may-26th</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1463577776473-E3FQCVQ56QAR5I8RMIEN/image-asset.png</image:loc>
      <image:title>Blog - Meet us at booth #1 at the BIOVIA event in Boston on May 23rd to May 26th</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/5/16/connect-tibco-spotfire-75-and-biovia-pipeline-pilot-2016-with-the-new-release-of-our-connector</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1463406642117-OHM7SDP8ZLA7C4ESPCYT/image-asset.png</image:loc>
      <image:title>Blog - Connect TIBCO Spotfire 7.5 with BIOVIA Pipeline Pilot 2016</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1463406588860-7SC1ZBEV1CBC101E5SYN/image-asset.png</image:loc>
      <image:title>Blog - Connect TIBCO Spotfire 7.5 with BIOVIA Pipeline Pilot 2016</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/4/6/discngine-sponsor-of-the-next-elrig-event-in-rennes-3-4-may</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1459957754421-3H99M647H7F7TZ7P1ULL/image-asset.png</image:loc>
      <image:title>Blog - DISCOVER THE LATEST VERSIONS OF ASSAY &amp;amp; SAMPLE LAUNCHED AT THE NEXT ELRIGfr EVENT !</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1460362553880-O2JWP6R333WZDTOK9VM2/image-asset.png</image:loc>
      <image:title>Blog - DISCOVER THE LATEST VERSIONS OF ASSAY &amp;amp; SAMPLE LAUNCHED AT THE NEXT ELRIGfr EVENT !</image:title>
      <image:caption>Discngine Assay Screenshot</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1460130240310-504SS2MXOI97O9Z7LJ8C/image-asset.png</image:loc>
      <image:title>Blog - DISCOVER THE LATEST VERSIONS OF ASSAY &amp;amp; SAMPLE LAUNCHED AT THE NEXT ELRIGfr EVENT !</image:title>
      <image:caption>Discngine Sample Screenshot</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/4/6/new-release-of-our-tibco-spotfire-connnector-for-pipeline-pilot</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1459960588231-UOGCH6RI5HX3BNBQXGQT/Pipeline+Pilot+Authentication+in+Spotfire+Web+Player</image:loc>
      <image:title>Blog - New release (3.2) of the TIBCO Spotfire Connector for Pipeline Pilot</image:title>
      <image:caption>Pipeline Pilot authentication form in Spotfire Web Player</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1459960700452-6MXEVSQ6YDV610H0TNN6/image-asset.png</image:loc>
      <image:title>Blog - New release (3.2) of the TIBCO Spotfire Connector for Pipeline Pilot</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/3/9/network-collection-201603-brings-formal-concept-analysis-to-your-desktops</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1459862290185-W9ZNR3VX7HMTX673QKE8/image-asset.png</image:loc>
      <image:title>Blog - Network Collection 2016 brings Formal Concept Analysis to your desktops</image:title>
      <image:caption>Example of clustering result using formal concept analysis and the Discngine Network Collection.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/3/6/chemistry-collection-201603-is-out-now</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1457224387863-XO3VUAM6V082HQU63WZR/image-asset.png</image:loc>
      <image:title>Blog - Chemistry Collection 2016 is out now</image:title>
      <image:caption>Example of superimposition of 2 ATP molecules from two crystal structures (1atp &amp; 3k5h) and their structural contexts. Two different protein folds bind the same conformation of ATP.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/2/4/discngine-assay-goes-responsive</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1454574177342-EAQBSRBG6QMICCK0FI1X/responsiveUI.png</image:loc>
      <image:title>Blog - Discngine Assay goes Responsive</image:title>
      <image:caption>Screening analysis and compound management on the go with Assay &amp; Sample 3.5.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1454666326484-WN0PW021OG0GDG8H0P22/Elisa_Validation_Fullscreen.PNG</image:loc>
      <image:title>Blog - Discngine Assay goes Responsive - Desktop</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1454666326829-EWD594MJQKJK1SMM1T3P/Elisa_Validation_Mobile.PNG</image:loc>
      <image:title>Blog - Discngine Assay goes Responsive - Mobile</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1454666326281-IIFL19E5HIYTRHR3J26F/Elisa_Analysis_Tablet.PNG</image:loc>
      <image:title>Blog - Discngine Assay goes Responsive - Tablet</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1454666326873-ZFUQEYW56HZT1ZJ344P1/Sample_tablet.PNG</image:loc>
      <image:title>Blog - Discngine Assay goes Responsive - Desktop</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1454666326156-FVSJCUM34RRJ2XIDXX3H/Sample_tablet4.PNG</image:loc>
      <image:title>Blog - Discngine Assay goes Responsive - Tablet</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1454666326987-P1J50Z3P5OJ8V67KVOMP/Sample_mobile4.PNG</image:loc>
      <image:title>Blog - Discngine Assay goes Responsive - Mobile</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1454666327185-C8NEJ82L0NTQYIQB3EXT/Sample_PC2.PNG</image:loc>
      <image:title>Blog - Discngine Assay goes Responsive - Desktop</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1454666327222-QCQ8H173KPHVFIVS559D/Sample_tablet3.PNG</image:loc>
      <image:title>Blog - Discngine Assay goes Responsive - Tablet</image:title>
      <image:caption />
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2016/1/11/new-year-new-offices</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1452535486503-AU4FTC3QFBWOTEIM5QO0/image-asset.png</image:loc>
      <image:title>Blog - New Year, New Offices!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1765275149987-PZ6ST08F3XGY6OV1JKWD/image-asset.png</image:loc>
      <image:title>Blog - New Year, New Offices!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1765275149987-PZ6ST08F3XGY6OV1JKWD/Discngine-Voeux2026.png</image:loc>
      <image:title>Blog - New Year, New Offices! - 2026 (Copy)</image:title>
      <image:caption>2026</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1736876869952-KAZPG2SKMU7HUTXJPKBG/Discngine-BestWishes2025-Finale.png</image:loc>
      <image:title>Blog - New Year, New Offices! - 2025 (Copy)</image:title>
      <image:caption>2025</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1701881617889-QWCT6FCQTK60JTASDX8Y/image-asset.png</image:loc>
      <image:title>Blog - New Year, New Offices! - 2024 (Copy)</image:title>
      <image:caption>2024</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1671040307999-GUW3NGOQM6IW3GOZI4IZ/image-asset.png</image:loc>
      <image:title>Blog - New Year, New Offices! - 2023 (Copy)</image:title>
      <image:caption>2023</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1639589267748-4V6ABJBF2BEM598OTZ97/Discngine+-+voeux+2022.png</image:loc>
      <image:title>Blog - New Year, New Offices! - 2022 (Copy)</image:title>
      <image:caption>2022</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1606472227137-5RUDRPNXTG3RKJOQ021R/image-asset.jpeg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2021 (Copy)</image:title>
      <image:caption>2021</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1576112531211-DM1SJTQP1GY0NKL2NJ1M/Discngine-voeux-2020.jpg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2020 (Copy)</image:title>
      <image:caption>2020 Happy New Year 2020! Discngine wishes you success in all your future endeavors!</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1545145175810-M3HRHRJ4N10C2O1KCSND/cdv_dng_2019.jpg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2019 (Copy)</image:title>
      <image:caption>2019 Discngine wishes you the best for the new year coming ahead!</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1513758917348-DPLIJ6RQQO4VRUTFLARM/cdv_dng_2018.jpg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2018 (Copy)</image:title>
      <image:caption>2018</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1483979347890-2VU3LXWQW3IM6NXTWE69/cdv_dng_2017.png</image:loc>
      <image:title>Blog - New Year, New Offices! - 2017 (Copy)</image:title>
      <image:caption>2017</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1452535143515-0KDUVGIP5B0S016ARMIO/image-asset.png</image:loc>
      <image:title>Blog - New Year, New Offices! - 2016 (Copy)</image:title>
      <image:caption>2016</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1420472861128-RMN9GVGQWDIC6K68PRA3/image-asset.jpeg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2015 (Copy)</image:title>
      <image:caption>2015</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1388064073895-0YG2SNZYCRTM8I5D9V20/Discngine-2---2014.jpg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2014 (Copy)</image:title>
      <image:caption>2014</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380329614-XLEUCRUPPGFQRKRG3N92/discngine+-+2013+-+finale-01.jpg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2013 (Copy)</image:title>
      <image:caption>2013</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380261311-AVWJJGADD5MGIJVVQOMZ/cdv_dng_2012.jpg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2012 (Copy)</image:title>
      <image:caption>2012</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380258076-7965VIZXMW3H2ICW3U12/cdv_dng_2011.jpg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2011 (Copy)</image:title>
      <image:caption>2011</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380253611-3J32TMGSTF4KB4KTCBR7/cdv_dng_2010.png</image:loc>
      <image:title>Blog - New Year, New Offices! - 2010 (Copy)</image:title>
      <image:caption>2010</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380246327-X3FQ8LX23OW8HXNDEGN8/cdv_dng_2009.jpg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2009 (Copy)</image:title>
      <image:caption>2009</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380237365-PKEDH3R39DZ46GI1BK2H/cdv_dng_2008.jpg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2008 (Copy)</image:title>
      <image:caption>2008</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380242643-EDR7L7RD1LUWVAQU9VFF/cdv_dng_2007.jpg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2007 (Copy)</image:title>
      <image:caption>2007</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380229481-VCFIP497MUQGHGNU7VXG/cdv_dng_2006.png</image:loc>
      <image:title>Blog - New Year, New Offices! - 2006 (Copy)</image:title>
      <image:caption>2006</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380224773-MZK50C8FQ02XM2Z2V1DH/cdv_dng_2005.jpg</image:loc>
      <image:title>Blog - New Year, New Offices! - 2005 (Copy)</image:title>
      <image:caption>2005</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2015/11/4/discngine-sponsor-of-the-german-conference-on-chemoinformatics-in-fulda</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1446644871600-2E5SSVKYYH6RYX9I98FN/image-asset.png</image:loc>
      <image:title>Blog - Discngine Sponsor of the German Conference on Chemoinformatics in Fulda</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2015/10/21/tibco-spotfire-connector-31-released</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1445441052015-X0CTJ7WCS77VKOQI8MP3/image-asset.png</image:loc>
      <image:title>Blog - TIBCO Spotfire Connector 3.1 released</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1445441080836-W69URYJD61MBWDFJREPE/image-asset.png</image:loc>
      <image:title>Blog - TIBCO Spotfire Connector 3.1 released</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2015/9/10/agile-development-summit-2015-on-olron-island</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1441960804066-70WCAT0EYIU8U3LCALK5/Chateau+du+Mesnil+Il+d%27Ol%C3%A9ron</image:loc>
      <image:title>Blog - Discngine Agile Development Summit 2015 on Oléron Island</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1441961006060-QFKU4WSNUMW5G6LG74O1/IMG_20150910_152506.png</image:loc>
      <image:title>Blog - Discngine Agile Development Summit 2015 on Oléron Island</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1441961093577-OHH9ZWW8N0VJZPZJT9X1/IMG_20150910_150834%7E2.png</image:loc>
      <image:title>Blog - Discngine Agile Development Summit 2015 on Oléron Island</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1441961199438-2FZVTTXNXXYM8J1SG400/IMG_20150910_130220%7E2.png</image:loc>
      <image:title>Blog - Discngine Agile Development Summit 2015 on Oléron Island</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1441961366198-UVZN7NX06JDBG26G7AMT/IMG_20150910_103215.png</image:loc>
      <image:title>Blog - Discngine Agile Development Summit 2015 on Oléron Island</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1441961284380-KEC9P5C1RLQYBPAFAUD3/IMG_2883.png</image:loc>
      <image:title>Blog - Discngine Agile Development Summit 2015 on Oléron Island</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1441961432754-68AOY3TR1HEUBQ1775CA/IMG_20150910_092153.png</image:loc>
      <image:title>Blog - Discngine Agile Development Summit 2015 on Oléron Island</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1445440032766-FMVAOLTTB9UEW3CZ3HV9/sable.JPG</image:loc>
      <image:title>Blog - Discngine Agile Development Summit 2015 on Oléron Island</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1445440029012-APAVA98R2CMVRSGKR5UH/team.jpg</image:loc>
      <image:title>Blog - Discngine Agile Development Summit 2015 on Oléron Island</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2015/6/18/tibco-spotfire-connector-for-pipeline-pilot-30</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1434643520731-7XBVP93ID1IHFDA65XTU/registerPPDataFunction.png</image:loc>
      <image:title>Blog - TIBCO Spotfire connector for Pipeline Pilot 3.0 - Register Protocols as Data Functions</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1434646141834-OZCBB7V90EJDC2TR50XS/ExecutePPDataFunction.png</image:loc>
      <image:title>Blog - TIBCO Spotfire connector for Pipeline Pilot 3.0 - Dynamically execute Protocols</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1434643539921-2E3M4ILHE2PQW3TJTZQ0/PPDataFunctionArchitecture.png</image:loc>
      <image:title>Blog - TIBCO Spotfire connector for Pipeline Pilot 3.0 - Execute in Both Spotfire Analyst and Web Player clients</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1434643167039-VWT4X13WLWN8VE7HP7LE/image-asset.png</image:loc>
      <image:title>Blog - TIBCO Spotfire connector for Pipeline Pilot 3.0</image:title>
      <image:caption>Spotfire Binary Data Format Reader &amp; Writer components</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1434643785944-Y6HR050ANPF1JMDNP1ZZ/Spotfire+7.0+support</image:loc>
      <image:title>Blog - TIBCO Spotfire connector for Pipeline Pilot 3.0</image:title>
      <image:caption>Spotfire 7.0 support</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1434699829846-B20OXB34TBXH48TQETC9/image-asset.png</image:loc>
      <image:title>Blog - TIBCO Spotfire connector for Pipeline Pilot 3.0</image:title>
      <image:caption>Discngine Web Panel User License control</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2015/4/22/aideas-abbvies-integrated-design-explorer-and-analytics-solution</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1429704540471-FNYH4U3BPIFVQL9WCKQ8/IMG_1725.png</image:loc>
      <image:title>Blog - AIDEAS - Abbvie's Integrated Design Explorer and Analytics Solution - Entrance of the BioIT-World Conference in Boston</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1429707882919-VHNVLP4ILHLXNDX329R8/IMG_1729_01.png</image:loc>
      <image:title>Blog - AIDEAS - Abbvie's Integrated Design Explorer and Analytics Solution</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2015/4/16/discngine-assay-30-launched-at-the-bio-it-world-2015-1</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1429257573409-MN8UEB9UUETD0YMFXBET/image-asset.png</image:loc>
      <image:title>Blog - Assay 3.0 launch at Bio-IT World 2015</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1429257222013-E3PT761UPSC7KEMHS05D/assay3.0_2.png</image:loc>
      <image:title>Blog - Assay 3.0 launch at Bio-IT World 2015</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1429257217407-87J9UP0KJWFFFGE66VR1/assay3.0.png</image:loc>
      <image:title>Blog - Assay 3.0 launch at Bio-IT World 2015</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2015/1/5/best-wishes-for-2015</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1420473265177-NCC03WRBICUFUZT827WL/image-asset.jpeg</image:loc>
      <image:title>Blog - Best wishes for 2015!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1765275149987-PZ6ST08F3XGY6OV1JKWD/image-asset.png</image:loc>
      <image:title>Blog - Best wishes for 2015!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1765275149987-PZ6ST08F3XGY6OV1JKWD/Discngine-Voeux2026.png</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2026 (Copy)</image:title>
      <image:caption>2026</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1736876869952-KAZPG2SKMU7HUTXJPKBG/Discngine-BestWishes2025-Finale.png</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2025 (Copy)</image:title>
      <image:caption>2025</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1701881617889-QWCT6FCQTK60JTASDX8Y/image-asset.png</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2024 (Copy)</image:title>
      <image:caption>2024</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1671040307999-GUW3NGOQM6IW3GOZI4IZ/image-asset.png</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2023 (Copy)</image:title>
      <image:caption>2023</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1639589267748-4V6ABJBF2BEM598OTZ97/Discngine+-+voeux+2022.png</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2022 (Copy)</image:title>
      <image:caption>2022</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1606472227137-5RUDRPNXTG3RKJOQ021R/image-asset.jpeg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2021 (Copy)</image:title>
      <image:caption>2021</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1576112531211-DM1SJTQP1GY0NKL2NJ1M/Discngine-voeux-2020.jpg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2020 (Copy)</image:title>
      <image:caption>2020 Happy New Year 2020! Discngine wishes you success in all your future endeavors!</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1545145175810-M3HRHRJ4N10C2O1KCSND/cdv_dng_2019.jpg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2019 (Copy)</image:title>
      <image:caption>2019 Discngine wishes you the best for the new year coming ahead!</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1513758917348-DPLIJ6RQQO4VRUTFLARM/cdv_dng_2018.jpg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2018 (Copy)</image:title>
      <image:caption>2018</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1483979347890-2VU3LXWQW3IM6NXTWE69/cdv_dng_2017.png</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2017 (Copy)</image:title>
      <image:caption>2017</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1452535143515-0KDUVGIP5B0S016ARMIO/image-asset.png</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2016 (Copy)</image:title>
      <image:caption>2016</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1420472861128-RMN9GVGQWDIC6K68PRA3/image-asset.jpeg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2015 (Copy)</image:title>
      <image:caption>2015</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1388064073895-0YG2SNZYCRTM8I5D9V20/Discngine-2---2014.jpg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2014 (Copy)</image:title>
      <image:caption>2014</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380329614-XLEUCRUPPGFQRKRG3N92/discngine+-+2013+-+finale-01.jpg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2013 (Copy)</image:title>
      <image:caption>2013</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380261311-AVWJJGADD5MGIJVVQOMZ/cdv_dng_2012.jpg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2012 (Copy)</image:title>
      <image:caption>2012</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380258076-7965VIZXMW3H2ICW3U12/cdv_dng_2011.jpg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2011 (Copy)</image:title>
      <image:caption>2011</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380253611-3J32TMGSTF4KB4KTCBR7/cdv_dng_2010.png</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2010 (Copy)</image:title>
      <image:caption>2010</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380246327-X3FQ8LX23OW8HXNDEGN8/cdv_dng_2009.jpg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2009 (Copy)</image:title>
      <image:caption>2009</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380237365-PKEDH3R39DZ46GI1BK2H/cdv_dng_2008.jpg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2008 (Copy)</image:title>
      <image:caption>2008</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380242643-EDR7L7RD1LUWVAQU9VFF/cdv_dng_2007.jpg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2007 (Copy)</image:title>
      <image:caption>2007</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380229481-VCFIP497MUQGHGNU7VXG/cdv_dng_2006.png</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2006 (Copy)</image:title>
      <image:caption>2006</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380224773-MZK50C8FQ02XM2Z2V1DH/cdv_dng_2005.jpg</image:loc>
      <image:title>Blog - Best wishes for 2015! - 2005 (Copy)</image:title>
      <image:caption>2005</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2014/11/20/discngine-chemistry-collection-for-pipeline-pilot-20-is-available-now</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416497197313-LO41HTCOC3IWFF9QK5RH/image-asset.png</image:loc>
      <image:title>Blog - Discngine Chemistry Collection 2.0 for Pipeline Pilot is available now</image:title>
      <image:caption>Sample protocol output using the the Chemistry Collection on epoxide hydratase compounds from Chembl.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2014/10/31/discngine-biophenics-2014-in-paris</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1414764266166-FL6FXPU5C1WJO6AKC82D/BioPhenics</image:loc>
      <image:title>Blog - Discngine @ Biophenics 2014 in Paris</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2014/10/30/enabling-matched-molecular-pairs-analysis-for-target-activity-prediction-on-small-datasets</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416210295267-PE4HASKORCJQP5D8I5L9/image-asset.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>Matched Pair example with the fragment coloured in red and the common core in gray.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416210955468-3CUMB4CJSZC7WV7BAEBX/image-asset.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>A second Matched Pair example with the fragment coloured in red and the common core in gray.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416217041373-3EWS1S2RPLXVTE577UGQ/activityEffectExample.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>Fictitious result of a MMP property / activity effect analysis on a particular transformation and a particular property of the molecule. Red: in 30% of observed transformations the property was deteriorated, in 40% improved and in 30% of all transformations no effect has been observed.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416213313596-5FUKHIUU6954IG5MO26N/coreContextExample.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>Sample molecule from above with fragment marked in red, common core in gray and different context sizes (n=1 to n=3) on the common core marked in green.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416228083292-6XO28S7X0130MX4TMTGC/image-asset.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>Example of a matched molecular pair using the pharmacophore graph representation on the common core.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416236001900-5NNVXT6PCK5JA4OVKT0I/fcsMMPContextExample.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>Sample molecule from above with fragment marked in red, common core in gray and different context sizes (n=1 to n=3) on the common core marked in green. The context is defined using the pharmacophore graph nodes.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416298248723-V2OE93IK86I4ZLLZIRZG/image-asset.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>Epoxide hydratase crystal structure</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416308766194-UREKQOBR24TYHYU5XINF/image-asset.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>Sample of one transformation yielding important activity shifts on common core sharing the same global topology and pharmacophoric features.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416322572816-7D08X4G08S43H2Q0LY81/image-asset.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>Epoxide hydratase results on 453 Chembl molecules with pIC50 data. Click on the image to enlarge.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416325660323-66XYN9MECC89J63598SN/vegfr2FullResults.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>VEGFR2 results on 397 Chembl molecules with pIC50 data. Click on the image to enlarge.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416487724708-0U5F5R4EE0IMP73AOX9K/image-asset.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>C-C chemokine receptor 2 results on 365 molecules with pIC50 data. Click on the image to enlarge.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416487867229-KQQ0UMULUL3KRBSX9TMH/image-asset.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>GPR24 results on 294 molecules with pIC50 data. Click on the image to enlarge.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416488029893-5QJEQ20MYXF8HO6OZOLS/image-asset.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>Liver Glycogen Phosphorylase results on only 62 molecules with pIC50 data. Click on the image to enlarge.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1416492278483-2GAZP1UL3ZAVYH7AE5L8/commonCoreExample.png</image:loc>
      <image:title>Blog - Enabling Matched Molecular Pairs Analysis for Target Activity Prediction on Small Datasets</image:title>
      <image:caption>Example of one transformation observed in the epoxide hydratase dataset. In the left box, cores in the activity effect class using classical MMP are shown. In the right box, cores using fcsMMP.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2014/10/21/tibco-spotfire-connector-for-pipeline-pilot-v211-is-out</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1413874842694-K1AVBPBLLL7BCFTZRH9H/image-asset.png</image:loc>
      <image:title>Blog - Tibco Spotfire Connector for Pipeline Pilot v2.1.1 is out!</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2014/8/6/f1000prime-associate-faculty-membership</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2014/6/27/install-torque-on-a-single-node-centos-64</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2014/5/5/discngine-accelrys-accelerate-washington-dc</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1399281628353-4LSUB1K8FSDFRIS536FU/Discngine_Connector_2.0</image:loc>
      <image:title>Blog - Discngine sponsor of Accelrys Accelerate 2014 in Washington, D.C.</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2014/1/30/dassault-system-acquires-accelrys</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1391077134420-GWE00CW7GFI00QYN5VGB/Accelrys_500px.png</image:loc>
      <image:title>Blog - Dassault Systèmes acquires Accelrys!</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1391077263753-RQ3FLUY1MEFAWV51GW82/dassault.jpeg</image:loc>
      <image:title>Blog - Dassault Systèmes acquires Accelrys!</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2014/1/9/happy-new-year-and-all-the-best-for-2014</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1765275149987-PZ6ST08F3XGY6OV1JKWD/image-asset.png</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1765275149987-PZ6ST08F3XGY6OV1JKWD/Discngine-Voeux2026.png</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2026 (Copy)</image:title>
      <image:caption>2026</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1736876869952-KAZPG2SKMU7HUTXJPKBG/Discngine-BestWishes2025-Finale.png</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2025 (Copy)</image:title>
      <image:caption>2025</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1701881617889-QWCT6FCQTK60JTASDX8Y/image-asset.png</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2024 (Copy)</image:title>
      <image:caption>2024</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1671040307999-GUW3NGOQM6IW3GOZI4IZ/image-asset.png</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2023 (Copy)</image:title>
      <image:caption>2023</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1639589267748-4V6ABJBF2BEM598OTZ97/Discngine+-+voeux+2022.png</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2022 (Copy)</image:title>
      <image:caption>2022</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1606472227137-5RUDRPNXTG3RKJOQ021R/image-asset.jpeg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2021 (Copy)</image:title>
      <image:caption>2021</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1576112531211-DM1SJTQP1GY0NKL2NJ1M/Discngine-voeux-2020.jpg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2020 (Copy)</image:title>
      <image:caption>2020 Happy New Year 2020! Discngine wishes you success in all your future endeavors!</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1545145175810-M3HRHRJ4N10C2O1KCSND/cdv_dng_2019.jpg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2019 (Copy)</image:title>
      <image:caption>2019 Discngine wishes you the best for the new year coming ahead!</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1513758917348-DPLIJ6RQQO4VRUTFLARM/cdv_dng_2018.jpg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2018 (Copy)</image:title>
      <image:caption>2018</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1483979347890-2VU3LXWQW3IM6NXTWE69/cdv_dng_2017.png</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2017 (Copy)</image:title>
      <image:caption>2017</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1452535143515-0KDUVGIP5B0S016ARMIO/image-asset.png</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2016 (Copy)</image:title>
      <image:caption>2016</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1420472861128-RMN9GVGQWDIC6K68PRA3/image-asset.jpeg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2015 (Copy)</image:title>
      <image:caption>2015</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1388064073895-0YG2SNZYCRTM8I5D9V20/Discngine-2---2014.jpg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2014 (Copy)</image:title>
      <image:caption>2014</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380329614-XLEUCRUPPGFQRKRG3N92/discngine+-+2013+-+finale-01.jpg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2013 (Copy)</image:title>
      <image:caption>2013</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380261311-AVWJJGADD5MGIJVVQOMZ/cdv_dng_2012.jpg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2012 (Copy)</image:title>
      <image:caption>2012</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380258076-7965VIZXMW3H2ICW3U12/cdv_dng_2011.jpg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2011 (Copy)</image:title>
      <image:caption>2011</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380253611-3J32TMGSTF4KB4KTCBR7/cdv_dng_2010.png</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2010 (Copy)</image:title>
      <image:caption>2010</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380246327-X3FQ8LX23OW8HXNDEGN8/cdv_dng_2009.jpg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2009 (Copy)</image:title>
      <image:caption>2009</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380237365-PKEDH3R39DZ46GI1BK2H/cdv_dng_2008.jpg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2008 (Copy)</image:title>
      <image:caption>2008</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380242643-EDR7L7RD1LUWVAQU9VFF/cdv_dng_2007.jpg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2007 (Copy)</image:title>
      <image:caption>2007</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380229481-VCFIP497MUQGHGNU7VXG/cdv_dng_2006.png</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2006 (Copy)</image:title>
      <image:caption>2006</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380224773-MZK50C8FQ02XM2Z2V1DH/cdv_dng_2005.jpg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014 - 2005 (Copy)</image:title>
      <image:caption>2005</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1389263476637-5RB7C2TSR6170608OZZJ/image-asset.jpeg</image:loc>
      <image:title>Blog - Happy new year and all the best for 2014</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2013/12/12/discngine-gcc2013</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1386923360142-KBL8I0TLORYW6DQRYNNM/fcsMMPoster_374px.png</image:loc>
      <image:title>Blog - Discngine @ the German Conference on Chemoinformatics 2013</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2013/12/11/creation-of-the-elrigfr-group</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1386758557217-00GIXK6QRW2V64K10KXW/img_143_elrig_launch_300.jpg</image:loc>
      <image:title>Blog - Creation of the Elrigfr group</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2013/7/5/video-what-is-behind-discngine-collections</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387374079293-TS3RBOQSHM2RLP9AA0OY/img_142_video_tech_summit.png</image:loc>
      <image:title>Blog - Video: What is behind Discngine Collections?</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/2013/5/1/discngineparis</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1386841239646-HX5CE8X65SGKW4K1E0OU/bastille.jpg</image:loc>
      <image:title>Blog - Discngine@Paris</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/category/Tech</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/category/Products</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/category/Discngine+Inside</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/category/Events</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://www.discngine.com/blog/category/Success+story</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://www.discngine.com/event</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-04-01</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2026/03/12/efmc-medicinal-chemistry</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ade0ae92-0143-4661-90ec-127e30d48459/Riccardo_Round.png</image:loc>
      <image:title>Events - 29th EFMC International Symposium on Medicinal Chemistry 2026 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/225cfcaa-b301-4ebd-81a2-a63efa17767b/GIF+3.gif</image:loc>
      <image:title>Events - 29th EFMC International Symposium on Medicinal Chemistry 2026 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2026/03/12/ccg-north-american-ugm-and-conference-2026</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2026/03/12/ccg-european-ugm-and-conference-2026</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/744764e6-cce3-498b-ae33-26274545b1bf/Ideation+and+9+more+pages+-+Work+-+Microsoft%E2%80%8B+Edge+18-Jun-25+3_13_53+PM.png</image:loc>
      <image:title>Events - CCG European UGM and Conference 2026 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2026/03/09/bio-it-world-conference-and-expo-2026</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/77ee35c6-b859-48f2-8f87-5441019cd8ba/Eric+Le+Roux</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2026 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ad5ffa0b-7fc7-4155-9382-9ff7c155e873/2.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2026 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/b19168cc-7183-4aa7-916d-f4a2b71a7aee/Raphael+Berthier</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2026 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0c0d5c81-4075-439f-9b38-098b6ef22784/1.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2026 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/cce0075e-9420-422b-90d2-4d862fd1ecf3/Discngine+at+Bio-IT+world+conference+%26+expo</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2026 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2026/03/05/37th-bmcs-spring-symposium-on-medicinal-chemistry</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ac234a25-9a57-4dbd-bb09-041253fd08e2/ricc.jpg</image:loc>
      <image:title>Events - 37th BMCS Spring Symposium on Medicinal Chemistry - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/79ddc8fd-5f47-426b-b69a-49659daa6bcb/Elisa.png</image:loc>
      <image:title>Events - 37th BMCS Spring Symposium on Medicinal Chemistry - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6ffa9f14-6c67-4149-8b95-12d641de8161/gif+3.2.gif</image:loc>
      <image:title>Events - 37th BMCS Spring Symposium on Medicinal Chemistry - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2026/3/17/discngine-labs-live-navigating-developability-challenges-across-advanced-modalities-computational-tools-amp-approaches</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1204e0bb-b05a-4dac-84ef-267041cb5d32/Banner+2.png</image:loc>
      <image:title>Events - Discngine Labs Live: Navigating Developability Challenges Across Antibody Modalities: Computational Tools &amp;amp; Approaches - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/1/19/biologic-summit-peptalk</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-01</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1ada8948-54c7-43b8-bef2-bf5481eb4407/Design+sans+titre.png</image:loc>
      <image:title>Events - BioLogic Summit &amp;amp; PepTalk 2026 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1008c8ef-11a1-48d9-92ee-a74ee6d648d7/Banner_2500px.png</image:loc>
      <image:title>Events - BioLogic Summit &amp;amp; PepTalk 2026 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/8/25/chemical-computing-group-bydesign-amp-workshops-s2kg8</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7dbd97fc-b959-4f5f-96c1-5355eaee73b0/CCG_Logo_20190318+%281%29.png</image:loc>
      <image:title>Events - Chemical Computing Group MedChem by Design - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/8/25/chemical-computing-group-bydesign-amp-workshops</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7dbd97fc-b959-4f5f-96c1-5355eaee73b0/CCG_Logo_20190318+%281%29.png</image:loc>
      <image:title>Events - Chemical Computing Group Drug Design workshop - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/10/16/certainty-discovery</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ac234a25-9a57-4dbd-bb09-041253fd08e2/ricc.jpg</image:loc>
      <image:title>Events - Certainty Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/7/8/discngine-at-pegs-europe-25</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1742813787993-EQ2OGXUA9WOM3W9FA40D/3dpredictab+%283%29.png</image:loc>
      <image:title>Events - Protein &amp;amp; Antibody Engineering Summit (PEGS) Europe - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/11/9/33rd-psdi-protein-structure-determination-in-industry-conference</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/97e5a0ba-7899-404c-a5c7-c398c794d98d/PSDI+2025</image:loc>
      <image:title>Events - 33rd Protein Structure Determination in Industry (PSDI) Meeting - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/10/16/discngine-meetup-vol-5</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/277e5506-a1ed-4d97-a25a-e781c4029e88/Banniere_finale+2500px.png</image:loc>
      <image:title>Events - Discngine Meetup Vol. 5 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/6/17/23rd-rsc-bmcs-sci-medicinal-chemistry-symposium</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1b24e61f-cd45-4c87-8473-800d51943c62/Raph.png</image:loc>
      <image:title>Events - 23rd RSC-BMCS / SCI Medicinal Chemistry Symposium - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/225cfcaa-b301-4ebd-81a2-a63efa17767b/GIF+3.gif</image:loc>
      <image:title>Events - 23rd RSC-BMCS / SCI Medicinal Chemistry Symposium - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/5/20/future-labs-live</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1b24e61f-cd45-4c87-8473-800d51943c62/Raph.png</image:loc>
      <image:title>Events - Future Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/6/10/4th-rsc-anglo-nordic-medicinal-chemistry-symposium</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ac234a25-9a57-4dbd-bb09-041253fd08e2/ricc.jpg</image:loc>
      <image:title>Events - 4th RSC Anglo-Nordic Medicinal Chemistry Symposium - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/a2526895-233b-42ce-8909-35ab63dfbea2/ana.jpg</image:loc>
      <image:title>Events - 4th RSC Anglo-Nordic Medicinal Chemistry Symposium - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/3/19/discngine-labs-live-in-cambridge-setting-new-standards-in-sbdd</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/eac421f1-aeb5-4ba6-bef4-60818e47c948/Banner+3.png</image:loc>
      <image:title>Events - Discngine Labs Live: Setting New Standards in SBDD: Experimental and Predicted Protein Structure Synergies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/05/24/ccg-north-american-ugm-and-conference-2025</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/a31ec686-892b-4bb1-b335-f4c45b631d50/Peter+at+the+talk.jpg</image:loc>
      <image:title>Events - Chemical Computing Group North American UGM and Conference 2025 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2025/5/20/ccg-european-ugm-and-conference-2025</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/58756d67-1d9f-46f4-9066-fab55e2c1f55/Peter.png</image:loc>
      <image:title>Events - CCG European UGM and Conference 2025 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2024/04/02/bio-it-world-conference-and-expo-2024</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d56687f3-fb28-4403-a076-664163a51033/Screenshot+2025-01-30+at+11.47.54%E2%80%AFAM.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2025 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5d11193f-ff50-4c1c-8c5f-3f646d52986d/35f51-ericvf.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2025 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/9bdcf4be-91ae-4cc2-a400-f7201f3a00c2/Riccardo.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2025 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1b24e61f-cd45-4c87-8473-800d51943c62/Raph.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2025 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/a8122360-b717-4168-aca0-3042193dcec4/Meline.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2025 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bff32c6b-3b09-4392-8bfd-c4fcdb7fd2cc/Ideation+and+5+more+pages+-+Work+-+Microsoft%E2%80%8B+Edge+20-Feb-25+5_38_49+PM.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2025 - Make it stand out</image:title>
      <image:caption>Discngine Ideation - SAR Slides</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/aac9e6d8-ca94-466a-b868-447008f3616a/Slide25.JPG</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2025 - Make it stand out</image:title>
      <image:caption>Discngine 3dpredict</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2024/11/05/pegs-europe-2024</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/58756d67-1d9f-46f4-9066-fab55e2c1f55/Peter.png</image:loc>
      <image:title>Events - PEGS Europe - Protein &amp;amp; Antibody Engineering Summit - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2024/10/16/slas-sample-management-symposium</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e3675fac-3344-48ce-b26b-83ee89b6b4ee/Ana.jpeg</image:loc>
      <image:title>Events - SLAS Sample Management Symposium - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585857671703-FBF29J4HPKY77YG90FZG/Thomas+vf.png</image:loc>
      <image:title>Events - SLAS Sample Management Symposium - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2024/10/08/discngine-meetup-vol-4</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1719499023873-Y6SD24G0J9S7L8PPCQ0Z/Banniere_green_FINAL.png</image:loc>
      <image:title>Events - Discngine Meetup Vol. 4 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2024/9/10/discngine-labs-fair-enabled-sample-management-with-discngine-sample</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/de6df504-c9cc-4e1c-8c87-d55dfda1411f/Banner24.png</image:loc>
      <image:title>Events - Discngine Labs: FAIR-enabled Sample Management with Discngine Assay - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585857671703-FBF29J4HPKY77YG90FZG/Thomas+vf.png</image:loc>
      <image:title>Events - Discngine Labs: FAIR-enabled Sample Management with Discngine Assay - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2024/11/10/psdi-2024</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0ff05f77-2d1f-4d57-a41a-9dedb6d2920a/signature+with+date.png</image:loc>
      <image:title>Events - PSDI 2024 - 32nd Protein Structure Determination in Industry Meeting - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/dd3880c0-be27-4255-bf96-b284c9d49997/exhibition-hall-plan-v2-only-plan.png</image:loc>
      <image:title>Events - PSDI 2024 - 32nd Protein Structure Determination in Industry Meeting - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2024/6/26/future-labs-live-2024</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2024/06/25/ccg-ugm-conference-north-america-2024</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2024/05/21/ccg-ugm-conference-europe-2024</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2024/2/7/slas2024</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585857671703-FBF29J4HPKY77YG90FZG/Thomas+vf.png</image:loc>
      <image:title>Events - SLAS 2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2b346dbf-ccee-4138-b260-2d20868c941f/1.png</image:loc>
      <image:title>Events - SLAS 2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/38931532-e4e3-432b-8158-27d22bd2ea0e/2.png</image:loc>
      <image:title>Events - SLAS 2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2024/04/07/bio-it-world-conference-2024</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0a630a06-77a7-4bb8-a53f-95106a809679/Screenshot+2024-03-05+at+2.57.10%E2%80%AFPM.jpg</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585857575052-QL38KZ7ML4IXVRVCG93W/Eric+vf.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1070e857-8995-488e-80b2-39534aba3d32/Lorena+circle.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e7c13af9-0943-4fd1-a9b5-c5aa114f930b/Medzi.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585857671703-FBF29J4HPKY77YG90FZG/Thomas+vf.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ade0ae92-0143-4661-90ec-127e30d48459/Riccardo_Round.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/11/29/bio-it-world-conference-expo-europe</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5d11193f-ff50-4c1c-8c5f-3f646d52986d/35f51-ericvf.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo Europe - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/9a8b04d1-d76b-4443-9132-8994c626e6b3/Sebastien.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo Europe - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e7c13af9-0943-4fd1-a9b5-c5aa114f930b/Medzi.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo Europe - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/11/28/discngine-labs-the-future-of-bioassay-data</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8dff53b9-15cd-45f4-b7f1-aed6d1125d6f/Logos.png</image:loc>
      <image:title>Events - Discngine Labs: The Future of Bioassay Data - A FAIR Implementation Discussion - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/9d2b0cca-1d99-47c0-b7be-d57ba7caf7c0/Nick+NB.png</image:loc>
      <image:title>Events - Discngine Labs: The Future of Bioassay Data - A FAIR Implementation Discussion - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7c051a85-f125-412f-b86b-9cd277b2d049/Isabella+NB.png</image:loc>
      <image:title>Events - Discngine Labs: The Future of Bioassay Data - A FAIR Implementation Discussion - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/79923a0d-f795-4b10-88c3-b92439a4a2a9/Mikkel+NB.png</image:loc>
      <image:title>Events - Discngine Labs: The Future of Bioassay Data - A FAIR Implementation Discussion - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/596075af-b0e6-4456-a0d1-453cd101afc2/Sam+NB.png</image:loc>
      <image:title>Events - Discngine Labs: The Future of Bioassay Data - A FAIR Implementation Discussion - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650470329450-E00745UCILBA6Q5PPXS1/DNG+Labs+blurred_blog.png</image:loc>
      <image:title>Events - Discngine Labs: The Future of Bioassay Data - A FAIR Implementation Discussion - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/576fa8cf-28dc-4be4-8e8d-31e5f2689bc0/bar+5+-+blurred.png</image:loc>
      <image:title>Events - Discngine Labs: The Future of Bioassay Data - A FAIR Implementation Discussion - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/11/8/discngine-x-nanome-maximizing-structure-based-drug-design-with-in-depth-structural-insights-and-virtual-reality</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1070e857-8995-488e-80b2-39534aba3d32/Lorena+circle.png</image:loc>
      <image:title>Events - Discngine Labs Live in Basel - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d4ed6a4c-df1e-4b10-9f1f-fe0c1acd8014/Roberta+Bartolotta+circle.png</image:loc>
      <image:title>Events - Discngine Labs Live in Basel - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/08/31/discngine-labs-harnessing-the-potential-of-structural-data-for-ideation-in-drug-discovery</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d9358d95-a800-46ed-928d-a3cf4d8fad0c/LogosFINAL.png</image:loc>
      <image:title>Events - Discngine Labs: Harnessing the Potential of Structural Data for Ideation in Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/178e78e3-fb04-4356-a150-14f1e0972efb/Simone+Fulle.png</image:loc>
      <image:title>Events - Discngine Labs: Harnessing the Potential of Structural Data for Ideation in Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5b0e5c27-8a72-4628-9841-204b7e141a8a/Daria+Goldmann.png</image:loc>
      <image:title>Events - Discngine Labs: Harnessing the Potential of Structural Data for Ideation in Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/fcaca39c-5e6b-4c4a-b69f-f8368b926af8/David+Thompson.png</image:loc>
      <image:title>Events - Discngine Labs: Harnessing the Potential of Structural Data for Ideation in Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/b7c1d900-2564-4dc9-91ae-b1e851ce1c0b/Simone+Exsci.png</image:loc>
      <image:title>Events - Discngine Labs: Harnessing the Potential of Structural Data for Ideation in Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650470329450-E00745UCILBA6Q5PPXS1/DNG+Labs+blurred_blog.png</image:loc>
      <image:title>Events - Discngine Labs: Harnessing the Potential of Structural Data for Ideation in Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/576fa8cf-28dc-4be4-8e8d-31e5f2689bc0/bar+5+-+blurred.png</image:loc>
      <image:title>Events - Discngine Labs: Harnessing the Potential of Structural Data for Ideation in Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/10/20/discngine-meetup-vol-2022</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f7aef8a5-c406-411e-9064-e56ccc0bc205/Discngine_banniere_Meetup_Vol2_2500px.png</image:loc>
      <image:title>Events - Discngine Meetup Vol. 2 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/10/12/discngine-meetup-vol-3</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/977af8ad-c961-4e27-9d6e-8f42f3662a51/Discngine_banniere_Meetup_Vol3_2500px.png</image:loc>
      <image:title>Events - Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/11/12/psdi-2023</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c4bbc213-ed42-462a-959d-d11832a50306/psdi_2023_banner_1.jpg</image:loc>
      <image:title>Events - 31st Protein Structure Determination in Industry Meeting - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8966b5c8-c46d-4f75-a6fa-0e2ac82df66e/No.9.png</image:loc>
      <image:title>Events - 31st Protein Structure Determination in Industry Meeting - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/10/4/biotechx-europe-conference</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/19b9a954-0629-4066-83df-59572a2f11e6/Lorena.png</image:loc>
      <image:title>Events - BioTechX Europe Conference - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c1ff9262-338f-4267-a805-0ac852b7edbf/Biotech+X.png</image:loc>
      <image:title>Events - BioTechX Europe Conference - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/10/10/europin-summer-school</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/3/15/knime-spring-summit</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ade0ae92-0143-4661-90ec-127e30d48459/Riccardo_Round.png</image:loc>
      <image:title>Events - KNIME Spring Summit 2023 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d0aa2a6a-51c5-468a-ab0c-16805fb7b7fb/Meline+circle.png</image:loc>
      <image:title>Events - KNIME Spring Summit 2023 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/03/09/discngine-labs-predicting-antibody-developability-in-silico-in-vitro-synergies</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/00566825-8fec-487c-bc48-649f7b98805b/Logos+FINAL.png</image:loc>
      <image:title>Events - Discngine Labs: Predicting Antibody Developability - In silico &amp;amp; In vitro synergies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/438aad93-a1cc-41aa-844d-a0f0da6f6262/Thierry+Wurch_NB.jpg</image:loc>
      <image:title>Events - Discngine Labs: Predicting Antibody Developability - In silico &amp;amp; In vitro synergies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6a62a51b-df6a-40eb-8eb5-6d292df33920/Eric+Chabrol_NB.jpg</image:loc>
      <image:title>Events - Discngine Labs: Predicting Antibody Developability - In silico &amp;amp; In vitro synergies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7a55dff7-204e-4f8c-b1ac-91f0ace6366c/Andrew+Henry_NB.jpg</image:loc>
      <image:title>Events - Discngine Labs: Predicting Antibody Developability - In silico &amp;amp; In vitro synergies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c9b00795-0ac8-4445-9234-a505dba54d63/Thomas-Bourquard.png</image:loc>
      <image:title>Events - Discngine Labs: Predicting Antibody Developability - In silico &amp;amp; In vitro synergies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650470329450-E00745UCILBA6Q5PPXS1/DNG+Labs+blurred_blog.png</image:loc>
      <image:title>Events - Discngine Labs: Predicting Antibody Developability - In silico &amp;amp; In vitro synergies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/576fa8cf-28dc-4be4-8e8d-31e5f2689bc0/bar+5+-+blurred.png</image:loc>
      <image:title>Events - Discngine Labs: Predicting Antibody Developability - In silico &amp;amp; In vitro synergies - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/6/20/ccg-north-american-ugm-and-conference</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/9d856ff0-da98-4fcb-8274-b4991ba762e3/ccglogo_new.png</image:loc>
      <image:title>Events - CCG North American UGM and Conference - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/5/30/ccg-european-ugm-and-conference</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/5/16/discngine-at-bio-it-world-2023</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/67b17fc4-d411-4244-a53c-820348f3285e/Discngine+floorplan+booth+622.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2023 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585857575052-QL38KZ7ML4IXVRVCG93W/Eric+vf.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2023 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ade0ae92-0143-4661-90ec-127e30d48459/Riccardo_Round.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2023 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/19b9a954-0629-4066-83df-59572a2f11e6/Lorena.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2023 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585857671703-FBF29J4HPKY77YG90FZG/Thomas+vf.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2023 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ebead5ee-3e77-41fa-b1ac-e4ad5e033e56/AdobeStock_235530265.jpg</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2023 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f871556a-5fe2-40b6-b647-1464865133c3/BAGIM.jpg</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2023 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2023/01/1/discngine-labs-protein-structure-prediction</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/66fa3a0d-4704-404b-a9f3-4cd0e42256c6/Logo+updateF.png</image:loc>
      <image:title>Events - Discngine Labs: Protein structure prediction - What’s next after AlphaFold? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2bce1d6b-09da-42e0-b358-db1c932b218b/Seth.png</image:loc>
      <image:title>Events - Discngine Labs: Protein structure prediction - What’s next after AlphaFold? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/730b9fec-d5c3-409b-91d8-de07b16ea125/Christian.png</image:loc>
      <image:title>Events - Discngine Labs: Protein structure prediction - What’s next after AlphaFold? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6a3468ea-56b8-46d7-a528-ba89dfe2642a/Jola.png</image:loc>
      <image:title>Events - Discngine Labs: Protein structure prediction - What’s next after AlphaFold? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c6a1c244-7218-4042-aa25-ffcf6de47056/Robbie.png</image:loc>
      <image:title>Events - Discngine Labs: Protein structure prediction - What’s next after AlphaFold? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8dee4189-effc-4dea-9db8-8fd296ffa208/Laksh.png</image:loc>
      <image:title>Events - Discngine Labs: Protein structure prediction - What’s next after AlphaFold? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1650470329450-E00745UCILBA6Q5PPXS1/DNG+Labs+blurred_blog.png</image:loc>
      <image:title>Events - Discngine Labs: Protein structure prediction - What’s next after AlphaFold? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/576fa8cf-28dc-4be4-8e8d-31e5f2689bc0/bar+5+-+blurred.png</image:loc>
      <image:title>Events - Discngine Labs: Protein structure prediction - What’s next after AlphaFold? - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/9/22/biovia-conference-2022</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/10/11/nexus-2022</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/10/17/discngine-at-oracle-cloudworld-2022</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/09/22/discngine-labs-the-future-of-cryo-em-in-pharma</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/571a2dd9-44ae-4967-ac09-08b901261f3c/Logos+WITH+TF.png</image:loc>
      <image:title>Events - Discngine Labs: The future of Cryo-EM in Pharma - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/53eef48f-5e92-46d7-8ca9-6b61586c601f/2.PNG</image:loc>
      <image:title>Events - Discngine Labs: The future of Cryo-EM in Pharma - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0e61054f-4dc7-4dbb-8f15-cffad93d30ab/1.PNG</image:loc>
      <image:title>Events - Discngine Labs: The future of Cryo-EM in Pharma - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/54348103-ccdd-454d-a0ad-868de466324e/3.PNG</image:loc>
      <image:title>Events - Discngine Labs: The future of Cryo-EM in Pharma - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/61b43c18-23f2-4155-8fa5-602cd365a2c2/4.PNG</image:loc>
      <image:title>Events - Discngine Labs: The future of Cryo-EM in Pharma - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/27275fe6-bc3a-40b2-be74-449b3b348bcb/DNG+Labs+blurred_blog.png</image:loc>
      <image:title>Events - Discngine Labs: The future of Cryo-EM in Pharma - Make it stand out</image:title>
      <image:caption>Discngine Labs Vol 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/10/23/psdi-2022</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/6/28/cecam-workshop-chasing-cvs-using-machine-learning-from-methods-development-to-biophysical-applications</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1653300380250-600WV9SRI4U2EITWLHND/logo+Cecam.png</image:loc>
      <image:title>Events - CECAM Workshop: Chasing CVs using Machine Learning: from methods development to biophysical applications - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/6/12/discngine-at-iccs-2022</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1521822926676-O6LZ5GE2BIBLB2LOYPDY/iccs_logo%5B1%5D.jpg</image:loc>
      <image:title>Events - 12th International Conference on Chemical Structures - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/5/29/chemaxon-ugm-participation</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1646074031249-1BJESTJ5SH6K7OWVFEV3/Social+promo_LinkedIn_event.png</image:loc>
      <image:title>Events - Chemaxon User Meeting Europe 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/06/23/discngine-labs-virtual-reality-for-collaborative-sbdd</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1a240e5c-ff2a-444c-b217-27bbe6c52e31/Logos+_+300piNEWBIG.png</image:loc>
      <image:title>Events - Discngine Labs: Virtual Reality for Structure-Based Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/24d442de-e498-42b0-a288-8e0fd840832e/Rishi+BW.png</image:loc>
      <image:title>Events - Discngine Labs: Virtual Reality for Structure-Based Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d4a83dbf-f277-4015-ae4d-1df3adf28756/Wilian+BW.png</image:loc>
      <image:title>Events - Discngine Labs: Virtual Reality for Structure-Based Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3fe37191-0d1e-44dc-9749-6115e9bb282e/Steve.jpg</image:loc>
      <image:title>Events - Discngine Labs: Virtual Reality for Structure-Based Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6a45a0ea-664c-4e66-adef-31578dbaab78/Carmine+.jpg</image:loc>
      <image:title>Events - Discngine Labs: Virtual Reality for Structure-Based Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/cca37d6f-ad7a-4657-b8ee-9ee33ac962e1/Marc2.jpg</image:loc>
      <image:title>Events - Discngine Labs: Virtual Reality for Structure-Based Drug Discovery - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/27275fe6-bc3a-40b2-be74-449b3b348bcb/DNG+Labs+blurred_blog.png</image:loc>
      <image:title>Events - Discngine Labs: Virtual Reality for Structure-Based Drug Discovery - Make it stand out</image:title>
      <image:caption>Discngine Labs Vol 1</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/4/14/discngine-labs-introducing-the-discngine-connector-for-live-design</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/51d44992-5f55-4f8d-9330-b02f7789b573/Logos.png</image:loc>
      <image:title>Events - Discngine Labs: Discngine Connector for LiveDesign® - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/819de2a2-0eb4-4c6c-9dd4-af6bbc6dae99/Connector%2BConcepts.png</image:loc>
      <image:title>Events - Discngine Labs: Discngine Connector for LiveDesign® - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5d11193f-ff50-4c1c-8c5f-3f646d52986d/Eric.png</image:loc>
      <image:title>Events - Discngine Labs: Discngine Connector for LiveDesign® - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7bfcef3f-bc1e-4e32-aeeb-2369c0c3ee4c/Guillaume+Paillard+final.jpg</image:loc>
      <image:title>Events - Discngine Labs: Discngine Connector for LiveDesign® - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8d26e8e2-cc46-4d8f-9963-fb355f85dd16/Gather.png</image:loc>
      <image:title>Events - Discngine Labs: Discngine Connector for LiveDesign® - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/3/8/efficient-biomolecular-structural-data-handling-and-analysis-chemaxon-and-discngine-joint-webinar</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2022/5/3/discngine-at-bio-it-world-2022</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0e77ec8c-8e22-4345-9a45-9a6dd4741fff/Floorplan+2.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ebead5ee-3e77-41fa-b1ac-e4ad5e033e56/AdobeStock_235530265.jpg</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585857575052-QL38KZ7ML4IXVRVCG93W/Eric+vf.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585857707407-F7V5F47Z4JGA0O6856WU/Anne-So+vf.PNG</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/19b9a954-0629-4066-83df-59572a2f11e6/Lorena.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585857671703-FBF29J4HPKY77YG90FZG/Thomas+vf.png</image:loc>
      <image:title>Events - Bio-IT World Conference &amp;amp; Expo 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2021/11/8/psdi-2021</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2021/11/2/biodata-world-congress-2021</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1633341906856-5X0FOD2BF2T1IOV2ILI3/Booth+Biodata.png</image:loc>
      <image:title>Events - BioData World Congress 2021 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1633337331466-IYECD2CC0SHFYO43OEGC/Lorena+Zara+-+Scientific+Business+Developer</image:loc>
      <image:title>Events - BioData World Congress 2021 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2021/10/21/digital-discovery-meet-up</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1631299952429-KDCSWK40FMOZLOJURH9P/Banniere_finale_web.png</image:loc>
      <image:title>Events - Digital Discovery Meet Up - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2021/ggmm-sfci-lille-2021</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2021/4/28/pdb50-inaugural-event</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2021/4/19/europin-summer-school-on-drug-design</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/companies-making-big-impact</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2020/9/29/bagim-round-table-future-directions-in-medicinal-chemistry</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1600379927190-PFQ6Q4A0FNJQWEXJDX4N/Bagim.jpeg</image:loc>
      <image:title>Events - DIGITAL ROUND TABLE: Future Directions in Medicinal Chemistry</image:title>
      <image:caption>BAGIM</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1600379981699-Z9RWRB3DLI4NLXJWF922/Novartis-Logo.png</image:loc>
      <image:title>Events - DIGITAL ROUND TABLE: Future Directions in Medicinal Chemistry</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/bioscreen2020</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/biodata-world-congress-2020</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1604432472122-6FB2O2C6035C13JP9XV6/Lorena+presentation+3+.png</image:loc>
      <image:title>Events - [Digital event] BioData World Congress 2020</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1604432680864-RHL1LG5OKSZA3DM5WXV9/premie%CC%80re+page_web.JPG</image:loc>
      <image:title>Events - [Digital event] BioData World Congress 2020</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/knime-spring-summit-2020</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/pistoia-alliance-annual-european-conference-2020</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2019/5/29/bioit-world-expo-2020</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2019/5/29/molecular-med-tri-con</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2019/5/29/global-perkinelmer-emea-nexus-2019</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2019/5/29/biodata-world-congress-2019</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2019/5/29/sfci2019</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2019/9/25/tibco-now</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2019/5/29/global-pharma-rampd-informatics-and-ai-congress-2019</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2019/7/14/grc-2019-computer-aided-drug-design</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2019/6/25/structure-biology-for-drug-discovery-swissf</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/acs-spring-2019</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1547733335334-NIYV6VBCQL8UFTKMVJ0G/gabi.png</image:loc>
      <image:title>Events - ACS National Meeting &amp;amp; Expo 2019</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/forum-labo-paris</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/discngine-qualification-webinar-oct-25-2018</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1539598742924-CA2WVGG98O44MAYZXIO1/Webinar+Qualification.png</image:loc>
      <image:title>Events - Discngine Qualification First Webinar!</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2019/4/16/bioit-2019</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2018/9/16/22nd-euroqsar</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2018/4/26/webinar-biomolecular-structures-how-to-maximize-the-value-of-what-you-already-have</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1523263426962-T47760EIDAOO3UQY9Y3H/86a58ba0-5aea-4e6f-8853-20a2da0b2426-original.png</image:loc>
      <image:title>Events - Webinar - Biomolecular structures: how to maximize the value of what you already have</image:title>
      <image:caption>This introductory webinar lists current pitfalls in structure-based drug discovery and introduces how we are intending to address these in 3decision.  We will show use cases highlighting the importance of good data management, persistence as well as proper handling of metadata in the scope of structure-based drug design projects.  Last, we will show an outline of the next decades of structure generation, emphasizing why proper structure management will become increasingly important.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2018/6/27/2018-slas-europe</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2018-04-09</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2018/6/6/6th-annual-discovery-chemistry-drug-design-congress</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2018/3/23/iccs-11th-international-conference-on-chemical-structures</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2018-03-23</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2018/3/23/biovia-forum-euro-2018</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2017/11/27/elrigfr-event-in-monaco</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1509718572380-HGZ45EGM1WY9JYL20LL3/Flyer-ElrigFr-Monaco-v_5sept2017.png</image:loc>
      <image:title>Events - ElrigFr event in Monaco</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2017/11/7/spotfire-event-perkinelmer-nexus-2017</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1509718815758-Z3TPO5JGRR0BB39JVG86/nexus2017.png</image:loc>
      <image:title>Events - Spotfire event: Revvity Nexus 2017</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2017/6/6/2017-european-biovia-forum</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1496305790571-DU2GL5X2GTE29BDP24NJ/image-asset.png</image:loc>
      <image:title>Events - 2017 EUROPEAN BIOVIA FORUM</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2017/5/23/bioit-world-2017-boston</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2016/11/6/12th-german-conference-on-chemoinformatics</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2016/11/3/spotfire-2016-data-analytics-rd-informatics-user-conference</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2016/6/6/biovia-european-forum-2016</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2016/5/23/science-in-the-age-of-experience-2016</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2015/11/8/11th-german-conference-on-chemoinformatics</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2015/4/17/bioit-world-2015-biovia-booth-318</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2014/5/14/10th-international-conference-on-chemical-structures-iccs</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/event/2014/4/7/accelrys-accelrate-2014</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/discngine-labs-live-basel-2026</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/ideation-analytics-gostar-integration</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/ideation-analytics-sar-slides-release-2-6</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/3dpredict-ab-release-202512</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/discngine-at-ccg-drug-design-workshops-cambridge</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/discngine-at-pegs-europe-2025</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/discngine-at-ccg-medchem-by-design-symposium</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/ideation-analytics-sar-slides-v2-4-release</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/discngine-meetup-vol5</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/rcs-bmcs-mechem-symposium-cambridge-uk-2025</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/3dpredict-ab-release-202509</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/book-review-rna-as-a-drug-target</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/ccg-north-american-ugm-meeting-2025</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/rsc-anglo-nordic-medchem-symposium-denmark-2025</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/ccg-european-ugm-oxford-uk-2025</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/future-labs-live-basel-2025</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/understanding-glycan-sensitive-vs-glycan-agnostic-pd-1-antibodies-using-3decision</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/3ddecision-release-2-0</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/bioit-2025</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/ideation-analytics-sar-slides-release-2-0</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/discngine-labs-live-cambridge</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/discngine-bayer-success-story</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/discngine-assay-6-5</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/3dpredict-ab-product-launch</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/challenges-and-opportunities-in-predicting-antibody-properties</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/news/category/Product+launch</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://www.discngine.com/news/category/Success+story</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://www.discngine.com/news/category/Content</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://www.discngine.com/news/category/Event</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://www.discngine.com/news/category/Product+news</loc>
    <changefreq>monthly</changefreq>
    <priority>0.5</priority>
  </url>
  <url>
    <loc>https://www.discngine.com/best-wishes</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1765275149987-PZ6ST08F3XGY6OV1JKWD/image-asset.png</image:loc>
      <image:title>Best Wishes</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1765275149987-PZ6ST08F3XGY6OV1JKWD/Discngine-Voeux2026.png</image:loc>
      <image:title>Best Wishes - 2026 (Copy)</image:title>
      <image:caption>2026</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1736876869952-KAZPG2SKMU7HUTXJPKBG/Discngine-BestWishes2025-Finale.png</image:loc>
      <image:title>Best Wishes - 2025 (Copy)</image:title>
      <image:caption>2025</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1701881617889-QWCT6FCQTK60JTASDX8Y/image-asset.png</image:loc>
      <image:title>Best Wishes - 2024 (Copy)</image:title>
      <image:caption>2024</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1671040307999-GUW3NGOQM6IW3GOZI4IZ/image-asset.png</image:loc>
      <image:title>Best Wishes - 2023 (Copy)</image:title>
      <image:caption>2023</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1639589267748-4V6ABJBF2BEM598OTZ97/Discngine+-+voeux+2022.png</image:loc>
      <image:title>Best Wishes - 2022 (Copy)</image:title>
      <image:caption>2022</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1606472227137-5RUDRPNXTG3RKJOQ021R/image-asset.jpeg</image:loc>
      <image:title>Best Wishes - 2021 (Copy)</image:title>
      <image:caption>2021</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1576112531211-DM1SJTQP1GY0NKL2NJ1M/Discngine-voeux-2020.jpg</image:loc>
      <image:title>Best Wishes - 2020 (Copy)</image:title>
      <image:caption>2020 Happy New Year 2020! Discngine wishes you success in all your future endeavors!</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1545145175810-M3HRHRJ4N10C2O1KCSND/cdv_dng_2019.jpg</image:loc>
      <image:title>Best Wishes - 2019 (Copy)</image:title>
      <image:caption>2019 Discngine wishes you the best for the new year coming ahead!</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1513758917348-DPLIJ6RQQO4VRUTFLARM/cdv_dng_2018.jpg</image:loc>
      <image:title>Best Wishes - 2018 (Copy)</image:title>
      <image:caption>2018</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1483979347890-2VU3LXWQW3IM6NXTWE69/cdv_dng_2017.png</image:loc>
      <image:title>Best Wishes - 2017 (Copy)</image:title>
      <image:caption>2017</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1452535143515-0KDUVGIP5B0S016ARMIO/image-asset.png</image:loc>
      <image:title>Best Wishes - 2016 (Copy)</image:title>
      <image:caption>2016</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1420472861128-RMN9GVGQWDIC6K68PRA3/image-asset.jpeg</image:loc>
      <image:title>Best Wishes - 2015 (Copy)</image:title>
      <image:caption>2015</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1388064073895-0YG2SNZYCRTM8I5D9V20/Discngine-2---2014.jpg</image:loc>
      <image:title>Best Wishes - 2014 (Copy)</image:title>
      <image:caption>2014</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380329614-XLEUCRUPPGFQRKRG3N92/discngine+-+2013+-+finale-01.jpg</image:loc>
      <image:title>Best Wishes - 2013 (Copy)</image:title>
      <image:caption>2013</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380261311-AVWJJGADD5MGIJVVQOMZ/cdv_dng_2012.jpg</image:loc>
      <image:title>Best Wishes - 2012 (Copy)</image:title>
      <image:caption>2012</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380258076-7965VIZXMW3H2ICW3U12/cdv_dng_2011.jpg</image:loc>
      <image:title>Best Wishes - 2011 (Copy)</image:title>
      <image:caption>2011</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380253611-3J32TMGSTF4KB4KTCBR7/cdv_dng_2010.png</image:loc>
      <image:title>Best Wishes - 2010 (Copy)</image:title>
      <image:caption>2010</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380246327-X3FQ8LX23OW8HXNDEGN8/cdv_dng_2009.jpg</image:loc>
      <image:title>Best Wishes - 2009 (Copy)</image:title>
      <image:caption>2009</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380237365-PKEDH3R39DZ46GI1BK2H/cdv_dng_2008.jpg</image:loc>
      <image:title>Best Wishes - 2008 (Copy)</image:title>
      <image:caption>2008</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380242643-EDR7L7RD1LUWVAQU9VFF/cdv_dng_2007.jpg</image:loc>
      <image:title>Best Wishes - 2007 (Copy)</image:title>
      <image:caption>2007</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380229481-VCFIP497MUQGHGNU7VXG/cdv_dng_2006.png</image:loc>
      <image:title>Best Wishes - 2006 (Copy)</image:title>
      <image:caption>2006</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387380224773-MZK50C8FQ02XM2Z2V1DH/cdv_dng_2005.jpg</image:loc>
      <image:title>Best Wishes - 2005 (Copy)</image:title>
      <image:caption>2005</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/slack</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2023-08-22</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1514985936521-SVCNN00WJGRD6EKKZBN5/slack+screenshot.png</image:loc>
      <image:title>slack</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1514985936521-SVCNN00WJGRD6EKKZBN5/slack+screenshot.png</image:loc>
      <image:title>slack</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/contact</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/digital-discovery-meeting-1</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-25</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1633017580836-11095HW1SP7YC42NL87R/Agenda+Digital+Discovery+Meetup</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625612294734-5XU5YLWP8B47RZRNVMFG/Banniere_finale.png</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1633017580836-11095HW1SP7YC42NL87R/Agenda+Digital+Discovery+Meetup</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1623768701335-KHG8X35XD9BBU0BQGUD1/Matt2.png</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625509198918-EQKV9R4RHW45G92TDQQO/Alexander+Amberg.png</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Alexander Amberg</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1623680531350-M0YD24QSH48QL1JZNE4P/David.png</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>David Orlando</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1623680563552-FJ0882PRCA49XWP9VXYB/Alain.png</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Alain Grelier</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1623771969488-VOKYC5ZX367G8AV57SX2/Alexey.png</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1624927226278-F4U58TLR5B8QMYW2ZTL6/Jan+dreher.png</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625765215669-GLDULQOJZWJYZ0QFV2D3/Rishi+Final.png</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1626199054963-3UY5IKZ8I4BFDIEV1NR9/Miriam.png</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1626718436139-Y8HK8B8BYDDMABLCEAEP/Manuel+Stritt</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1628082599975-ZUL29SEUD6Y7L6NNYQQ7/photo2+alicia.jpg</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625765454641-X1SYDHHNZ8PM405BNXQZ/no+speaker.png</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1623050127592-NWHJXKWYVZ8S937NK264/gathertown.png</image:loc>
      <image:title>Digital Discovery meeting by Discngine (Copy) - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/discngine-meetup-2022</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2023-07-07</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f7aef8a5-c406-411e-9064-e56ccc0bc205/Discngine_banniere_Meetup_Vol2_2500px.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>smaller</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e93f7cb2-fe7d-41bf-ae93-ead021327460/Meetup+Agenda+2022+-+11.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Click on the image to enlarge</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5ece4970-c5be-473b-bb7b-8c2cb8884736/Andreas+Bender.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6a24ce69-b530-440b-ae73-7ba0ef0995ae/Rishi+Final.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/43af6723-baf2-4d67-904f-9977df7f1ac0/Jennifer+Heymont.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1f9dc601-06ac-4218-bcc9-bf92bbfd9ba2/Nick+Lynch.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1a63b673-d809-440b-9494-ae79e5199731/Louise+Owen.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/fa7e95a5-1222-4fe7-981f-d356fe87a872/Claire+Minoletti.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/eac724ca-f832-4111-9ecd-b325b2e7ca05/Dave+Brown.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c7056ffb-ddd9-49c3-af5d-6f49c203693e/Darren+Green.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5cd1511d-c2a1-4438-9134-414feeac6d60/Sylvie+Gomez.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f7aef8a5-c406-411e-9064-e56ccc0bc205/Discngine_banniere_Meetup_Vol2_2500px.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>smaller</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e93f7cb2-fe7d-41bf-ae93-ead021327460/Meetup+Agenda+2022+-+11.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Click on the image to enlarge</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5ece4970-c5be-473b-bb7b-8c2cb8884736/Andreas+Bender.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6a24ce69-b530-440b-ae73-7ba0ef0995ae/Rishi+Final.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/43af6723-baf2-4d67-904f-9977df7f1ac0/Jennifer+Heymont.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1f9dc601-06ac-4218-bcc9-bf92bbfd9ba2/Nick+Lynch.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1a63b673-d809-440b-9494-ae79e5199731/Louise+Owen.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/fa7e95a5-1222-4fe7-981f-d356fe87a872/Claire+Minoletti.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/eac724ca-f832-4111-9ecd-b325b2e7ca05/Dave+Brown.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c7056ffb-ddd9-49c3-af5d-6f49c203693e/Darren+Green.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5cd1511d-c2a1-4438-9134-414feeac6d60/Sylvie+Gomez.png</image:loc>
      <image:title>Discngine Meetup 2022 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/iso-27001</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2024-12-18</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/93cbbb4c-0771-4abd-b586-ac6bff5f6944/mark-of-trust-certified-ISOIECblue.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7b560631-b353-4415-b41a-ede972a94afc/secure-data.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ee5ce0fa-8a91-4d62-b83c-a8b6328b01fe/privacy-policy.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ee598e4d-1236-4b17-ab23-d81687c49fb4/evaluation.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/9402bb5b-93ad-40a9-9a00-9721541da690/incognito.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/a7db4917-ac39-4ecc-9fe3-20674b21e185/workflow.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bff480db-a044-43b5-ad28-ad1c6c68162c/first+page+FINAL+frame.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/93cbbb4c-0771-4abd-b586-ac6bff5f6944/mark-of-trust-certified-ISOIECblue.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7b560631-b353-4415-b41a-ede972a94afc/secure-data.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ee5ce0fa-8a91-4d62-b83c-a8b6328b01fe/privacy-policy.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ee598e4d-1236-4b17-ab23-d81687c49fb4/evaluation.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/9402bb5b-93ad-40a9-9a00-9721541da690/incognito.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/a7db4917-ac39-4ecc-9fe3-20674b21e185/workflow.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bff480db-a044-43b5-ad28-ad1c6c68162c/first+page+FINAL+frame.png</image:loc>
      <image:title>ISO 27001 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/events</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-04-02</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/discngine-meetup-2023</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2023-10-19</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8ffaa461-4d95-4d8b-b2e0-00f4247be46c/Discngine_banniere_Meetup_Vol3_2500px_V2.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/cfc85492-3b57-4d5e-a95e-6602554420f4/for+social+final+pic1.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>The atmosphere at the Discngine Meetup Vol.2 hosted on Gather.Town platform</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5fc9d14a-1f30-422c-8b4a-eab2ceb90ede/Leonardo+circle.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533314248-TFD1A15AP2ER5R1XDFLT/AstraZeneca.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5e86fd62-2f29-471b-916a-58f2d86cd590/Yves+circle.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4e6f49c1-0423-426c-ae40-ae0bd6c20ad8/Logo_Sanofi_%282022%29.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c51b3cb2-6ddc-4ebd-b9f0-4bf9cc448afb/Barbara.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bfdee3ba-8683-4a1f-9208-704b5f68bdb7/Novartis.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/14af4008-c1cf-4c9b-89e7-c3729752a975/Thierry+Dorval</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3d8aba59-600c-4122-ac2b-e89d4b8b5ecc/Servier_Logo.jpeg</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f6e7880c-dce8-44d4-a52b-aaa7a27ccc47/Phillipe+circle.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7dbd97fc-b959-4f5f-96c1-5355eaee73b0/CCG_Logo_20190318+%281%29.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/9f6a378a-8510-4ebd-9db5-860b66fcdea1/Kenneth+Longo+circle.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/79c6ccb5-eb10-4f3e-ad9a-dd80a507bf8a/Wave-Logo-without-Swoosh_R.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c51b3cb2-6ddc-4ebd-b9f0-4bf9cc448afb/Barbara.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bfdee3ba-8683-4a1f-9208-704b5f68bdb7/Novartis.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/71432ad9-0c1a-4644-9320-a95d91dacff9/Lars+Brive+circle.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533314248-TFD1A15AP2ER5R1XDFLT/AstraZeneca.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8ffaa461-4d95-4d8b-b2e0-00f4247be46c/Discngine_banniere_Meetup_Vol3_2500px_V2.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/cfc85492-3b57-4d5e-a95e-6602554420f4/for+social+final+pic1.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>The atmosphere at the Discngine Meetup Vol.2 hosted on Gather.Town platform</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5fc9d14a-1f30-422c-8b4a-eab2ceb90ede/Leonardo+circle.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533314248-TFD1A15AP2ER5R1XDFLT/AstraZeneca.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5e86fd62-2f29-471b-916a-58f2d86cd590/Yves+circle.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4e6f49c1-0423-426c-ae40-ae0bd6c20ad8/Logo_Sanofi_%282022%29.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c51b3cb2-6ddc-4ebd-b9f0-4bf9cc448afb/Barbara.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bfdee3ba-8683-4a1f-9208-704b5f68bdb7/Novartis.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/14af4008-c1cf-4c9b-89e7-c3729752a975/Thierry+Dorval</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3d8aba59-600c-4122-ac2b-e89d4b8b5ecc/Servier_Logo.jpeg</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f6e7880c-dce8-44d4-a52b-aaa7a27ccc47/Phillipe+circle.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7dbd97fc-b959-4f5f-96c1-5355eaee73b0/CCG_Logo_20190318+%281%29.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/9f6a378a-8510-4ebd-9db5-860b66fcdea1/Kenneth+Longo+circle.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/79c6ccb5-eb10-4f3e-ad9a-dd80a507bf8a/Wave-Logo-without-Swoosh_R.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c51b3cb2-6ddc-4ebd-b9f0-4bf9cc448afb/Barbara.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bfdee3ba-8683-4a1f-9208-704b5f68bdb7/Novartis.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/71432ad9-0c1a-4644-9320-a95d91dacff9/Lars+Brive+circle.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533314248-TFD1A15AP2ER5R1XDFLT/AstraZeneca.png</image:loc>
      <image:title>Discngine Meetup Vol. 3 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/discngine-meetup-2024</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-09-24</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/66aa12f7-214e-4f1b-b3bc-abebabcce1e2/Banniere_green_FINAL.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ac568fb1-90ef-4708-bb61-07e20c1f2713/Norbert.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4e6f49c1-0423-426c-ae40-ae0bd6c20ad8/Logo_Sanofi_%282022%29.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585857575052-QL38KZ7ML4IXVRVCG93W/Eric+vf.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1589221852311-ZJ55XHJ3KCIR6AM1PW93/discngine_logo.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/58756d67-1d9f-46f4-9066-fab55e2c1f55/Peter.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1584396946679-V7SQGSZC65VLXEZS9S3E/Discngine-Logo-Couleur-Big-Fond.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e2235a1e-538b-4f3b-854e-3e89699d6e07/Per.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/14ce1828-f0be-4b84-8eaf-198d2e29350a/BioMap+logo.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2989dd13-ff52-44d9-8ccf-23953cf6bbcc/Matthiew.jpg</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ffe35c7d-2eb8-4f65-82ec-1d364adcbbdf/University+of+Oxford2.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6e51ac1d-4198-4b33-95c3-1e41c9c20801/Essam.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1544092511472-6CUPP0KL4JP06W810F7D/Merck.jpg</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3115c7ff-3b09-476f-a113-59c5cbff06e5/Nels.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7dbd97fc-b959-4f5f-96c1-5355eaee73b0/CCG_Logo_20190318+%281%29.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/66aa12f7-214e-4f1b-b3bc-abebabcce1e2/Banniere_green_FINAL.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ac568fb1-90ef-4708-bb61-07e20c1f2713/Norbert.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4e6f49c1-0423-426c-ae40-ae0bd6c20ad8/Logo_Sanofi_%282022%29.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1585857575052-QL38KZ7ML4IXVRVCG93W/Eric+vf.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1589221852311-ZJ55XHJ3KCIR6AM1PW93/discngine_logo.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/58756d67-1d9f-46f4-9066-fab55e2c1f55/Peter.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1584396946679-V7SQGSZC65VLXEZS9S3E/Discngine-Logo-Couleur-Big-Fond.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e2235a1e-538b-4f3b-854e-3e89699d6e07/Per.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/14ce1828-f0be-4b84-8eaf-198d2e29350a/BioMap+logo.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2989dd13-ff52-44d9-8ccf-23953cf6bbcc/Matthiew.jpg</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ffe35c7d-2eb8-4f65-82ec-1d364adcbbdf/University+of+Oxford2.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6e51ac1d-4198-4b33-95c3-1e41c9c20801/Essam.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1544092511472-6CUPP0KL4JP06W810F7D/Merck.jpg</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3115c7ff-3b09-476f-a113-59c5cbff06e5/Nels.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7dbd97fc-b959-4f5f-96c1-5355eaee73b0/CCG_Logo_20190318+%281%29.png</image:loc>
      <image:title>Discngine-Meetup-2024 - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/professional-equality-index</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
  </url>
  <url>
    <loc>https://www.discngine.com/discngine-labs-live-in-cambridge</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-03-19</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c706c2a0-d2e9-4d44-b9ff-c83d913d3e26/Banner+3.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/88f60baa-21cf-4e3d-ab69-ffac6b750195/Untitled+design.jpg</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d3155746-2857-4267-9dcf-fad7036ce8b4/PXL_20230518_225827062.jpg</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1abba510-f172-42e0-834e-befda2b44669/discngine_logo_color_light_no+BG.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533314248-TFD1A15AP2ER5R1XDFLT/AstraZeneca.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3c7897fc-79d5-4d67-81cc-a33349437b95/Vertex_logo.svg.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/fecedd41-8a6c-42fb-af8c-e4a84753265a/Vernalis+logo+no+research+v3_0.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/25b1662b-5d45-4790-8d00-366bb2e0eea8/astex_hrz_logo_rgb.jpg</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c7056ffb-ddd9-49c3-af5d-6f49c203693e/Darren+Green.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/45ae6040-d354-4912-8bb2-a0ee60439db5/Dave+Brown.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/18777e41-50e8-4c31-bb7f-5816b4ce98b3/Juan+Carlos+circle1.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5b55ac8d-08bf-4492-abd4-a63af9a77e4a/James+Davidson.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0f0c903e-d02a-4ebc-a596-893c0f463910/Benoit+Baillif.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/edd47592-c8c8-4c06-8db5-6d9117fe2435/Screenshot+2024-12-19+at+4.10.16%E2%80%AFPM.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Churchill College - Wolfson Foyer &amp; Jock Colville Hall</image:title>
      <image:caption>University of Cambridge, Storey's Way, Cambridge CB3 0DS, United Kingdom - Map Visitor Map: https://www.chu.cam.ac.uk/about/contact/visitor-map/</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c706c2a0-d2e9-4d44-b9ff-c83d913d3e26/Banner+3.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/88f60baa-21cf-4e3d-ab69-ffac6b750195/Untitled+design.jpg</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d3155746-2857-4267-9dcf-fad7036ce8b4/PXL_20230518_225827062.jpg</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1abba510-f172-42e0-834e-befda2b44669/discngine_logo_color_light_no+BG.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533314248-TFD1A15AP2ER5R1XDFLT/AstraZeneca.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3c7897fc-79d5-4d67-81cc-a33349437b95/Vertex_logo.svg.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/fecedd41-8a6c-42fb-af8c-e4a84753265a/Vernalis+logo+no+research+v3_0.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/25b1662b-5d45-4790-8d00-366bb2e0eea8/astex_hrz_logo_rgb.jpg</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c7056ffb-ddd9-49c3-af5d-6f49c203693e/Darren+Green.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1070e857-8995-488e-80b2-39534aba3d32/Lorena+circle.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/45ae6040-d354-4912-8bb2-a0ee60439db5/Dave+Brown.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/18777e41-50e8-4c31-bb7f-5816b4ce98b3/Juan+Carlos+circle1.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5b55ac8d-08bf-4492-abd4-a63af9a77e4a/James+Davidson.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/0f0c903e-d02a-4ebc-a596-893c0f463910/Benoit+Baillif.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/edd47592-c8c8-4c06-8db5-6d9117fe2435/Screenshot+2024-12-19+at+4.10.16%E2%80%AFPM.png</image:loc>
      <image:title>Discngine Labs Live in Cambridge - Churchill College - Wolfson Foyer &amp; Jock Colville Hall</image:title>
      <image:caption>University of Cambridge, Storey's Way, Cambridge CB3 0DS, United Kingdom - Map Visitor Map: https://www.chu.cam.ac.uk/about/contact/visitor-map/</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/discnginemeetup2025-recording</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2025-10-17</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/67f8c597-8b0d-4c4c-b036-b9a3d2793c45/Banniere_finale+high+quality.jpg</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5fc9d14a-1f30-422c-8b4a-eab2ceb90ede/Leonardo+circle.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533314248-TFD1A15AP2ER5R1XDFLT/AstraZeneca.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7158769e-1c47-4ade-b3e8-c80e2bf51e44/Speaker+circle+pic+-+Meetup+Vol.5+-+Jennifer.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1544092511472-6CUPP0KL4JP06W810F7D/Merck.jpg</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5fc9d14a-1f30-422c-8b4a-eab2ceb90ede/Leonardo+circle.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533314248-TFD1A15AP2ER5R1XDFLT/AstraZeneca.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/777b5e0a-436a-4d33-adc6-1dc59f0f2a12/Speaker+circle+pic+-+Meetup+Vol.5+-+Alec.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1600379981699-Z9RWRB3DLI4NLXJWF922/Novartis-Logo.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7158769e-1c47-4ade-b3e8-c80e2bf51e44/Speaker+circle+pic+-+Meetup+Vol.5+-+Jennifer.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f7bbee1c-908e-437e-a118-5060cebecab0/Speaker+circle+pic+-+Meetup+Vol.5+-+Markus.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/cd9b5f06-7e3c-44dc-8e2a-95220ec295d2/Meetup+event+pic.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/67f8c597-8b0d-4c4c-b036-b9a3d2793c45/Banniere_finale+high+quality.jpg</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5fc9d14a-1f30-422c-8b4a-eab2ceb90ede/Leonardo+circle.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533314248-TFD1A15AP2ER5R1XDFLT/AstraZeneca.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7158769e-1c47-4ade-b3e8-c80e2bf51e44/Speaker+circle+pic+-+Meetup+Vol.5+-+Jennifer.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1544092511472-6CUPP0KL4JP06W810F7D/Merck.jpg</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5fc9d14a-1f30-422c-8b4a-eab2ceb90ede/Leonardo+circle.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533314248-TFD1A15AP2ER5R1XDFLT/AstraZeneca.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/777b5e0a-436a-4d33-adc6-1dc59f0f2a12/Speaker+circle+pic+-+Meetup+Vol.5+-+Alec.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1600379981699-Z9RWRB3DLI4NLXJWF922/Novartis-Logo.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7158769e-1c47-4ade-b3e8-c80e2bf51e44/Speaker+circle+pic+-+Meetup+Vol.5+-+Jennifer.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1544092511472-6CUPP0KL4JP06W810F7D/Merck.jpg</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f7bbee1c-908e-437e-a118-5060cebecab0/Speaker+circle+pic+-+Meetup+Vol.5+-+Markus.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7dbd97fc-b959-4f5f-96c1-5355eaee73b0/CCG_Logo_20190318+%281%29.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/cd9b5f06-7e3c-44dc-8e2a-95220ec295d2/Meetup+event+pic.png</image:loc>
      <image:title>Discngine-Meetup-2025 recording - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/discngine-solutions-overview</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-04-07</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/334fbcb3-3d5e-44c2-b5e3-ba0cc53c745f/image+%283%29.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4f71da80-9397-454f-b245-8519e3349c31/3dpredict%2FAb</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7ed33f39-18a7-421d-98de-644a56b682f6/Ideation+SAR+Slides</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/095bd470-9898-44ae-9329-76f5138be6bc/Discngine+Assay</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/05f2ce8b-8126-45e7-8c35-5523ffe02703/Discngine+Connector</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5dddf622-16f5-4244-bb1c-6594e68a2adb/Discngine+Services</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4151b8b4-4ef7-4377-a2f8-8a0333e4daf5/Discngine+3decision</image:loc>
      <image:title>Solutions overview</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4f71da80-9397-454f-b245-8519e3349c31/3dpredict%2FAb</image:loc>
      <image:title>Solutions overview</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/7ed33f39-18a7-421d-98de-644a56b682f6/Ideation+SAR+Slides</image:loc>
      <image:title>Solutions overview</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/095bd470-9898-44ae-9329-76f5138be6bc/Discngine+Assay</image:loc>
      <image:title>Solutions overview - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/05f2ce8b-8126-45e7-8c35-5523ffe02703/Discngine+Connector</image:loc>
      <image:title>Solutions overview - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5dddf622-16f5-4244-bb1c-6594e68a2adb/Discngine+Services</image:loc>
      <image:title>Solutions overview - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/discngine-labs-live-in-basel</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-27</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/96478727-0ee0-4882-8b07-f7793c3d99fd/Banner+2.png</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8c8e9cd5-d04e-4b5e-a48d-ced0fba297b4/Speaker+company+logos+Labs.png</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/76cfeb5c-a085-4d3d-9f6a-e1a76a333339/Bruck+Taddese</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/461cc7d2-04bd-4056-a3d4-efbe0b0058ca/Giuseppe+Licari</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/065b3859-64a7-4bb7-93df-732abb72eed3/Tarik+Khan</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e4a01cc9-a3a5-49b2-9896-a76a3c99c4f4/Peter.png</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/79beab36-3bfb-48c6-aa1a-9d133d021b3d/Andrew+H+CCG.png</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/979e356a-7900-46a9-ba96-e3a7a92877b9/t-d-s00020011912147451.jpg</image:loc>
      <image:title>COPY Discngine Labs Live - Hyperion Hotel Basel</image:title>
      <image:caption>Geneva 4 Conference Room - third floor Messeplatz 12 4058 Basel, CH Map</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/96478727-0ee0-4882-8b07-f7793c3d99fd/Banner+2.png</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8c8e9cd5-d04e-4b5e-a48d-ced0fba297b4/Speaker+company+logos+Labs.png</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/76cfeb5c-a085-4d3d-9f6a-e1a76a333339/Bruck+Taddese</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/461cc7d2-04bd-4056-a3d4-efbe0b0058ca/Giuseppe+Licari</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/065b3859-64a7-4bb7-93df-732abb72eed3/Tarik+Khan</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e4a01cc9-a3a5-49b2-9896-a76a3c99c4f4/Peter.png</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/79beab36-3bfb-48c6-aa1a-9d133d021b3d/Andrew+H+CCG.png</image:loc>
      <image:title>COPY Discngine Labs Live - Make it stand out</image:title>
      <image:caption>Whatever it is, the way you tell your story online can make all the difference.</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/979e356a-7900-46a9-ba96-e3a7a92877b9/t-d-s00020011912147451.jpg</image:loc>
      <image:title>COPY Discngine Labs Live - Hyperion Hotel Basel</image:title>
      <image:caption>Geneva 4 Conference Room - third floor Messeplatz 12 4058 Basel, CH Map</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1768233100292-HJ5C6F0GNO600NTVNM6S/IMG_3696.png</image:loc>
      <image:title>COPY Discngine Labs Live</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1768233441677-IGE8KBBS67Y94VMX02X8/IMG_3800+%281%29.png</image:loc>
      <image:title>COPY Discngine Labs Live</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1768233224172-MNQJDW42WW1VZVF040YF/IMG_3769.png</image:loc>
      <image:title>COPY Discngine Labs Live</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1768400999602-X4NJ164P6OSDAVHQBEAR/IMG_3866.jpg</image:loc>
      <image:title>COPY Discngine Labs Live</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/discngine-cloud-infrastructure</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/822f238e-f702-4478-8d5d-d39bfee0d4f7/mark-of-trust-certified-ISOIEC-27001-information-security-management-white-logo-En-GB-1019+copy.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2e1ba25a-4257-4d16-b351-e5a0cec621ad/Screen+Shot+2022-05-30+at+2.41.07+PM.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6bf4a06f-32c0-4c63-af87-4daf1085c096/Screen+Shot+2022-05-30+at+4.19.45+PM+-+2.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/22567b9f-d792-4f8a-9f6f-a824d5bbbcf8/Screen+Shot+2022-05-30+at+1.52.00+PM.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/71d0b8c8-a67c-457e-a7fb-8350819fe6f2/Screen+Shot+2022-05-30+at+1.52.08+PM.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3b5fdb8b-f4cd-4139-88d6-9f23452919d3/Screen+Shot+2022-05-30+at+1.52.20+PM.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/49cab8a7-d2cb-4cdf-b286-cead250799dc/Screen+Shot+2022-05-30+at+1.52.28+PM.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/489461db-9835-4b4f-93eb-87bcbd444284/Screen+Shot+2022-05-30+at+1.52.37+PM.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/23db6d20-90db-463f-968f-b296da7ffc7c/Screen+Shot+2022-05-30+at+1.52.45+PM.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f365b78c-1556-47e1-a643-f84dd8fecfbc/Screen+Shot+2022-05-30+at+1.52.53+PM.png</image:loc>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/livedesign-connector-for-spotfire</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/19e7d12b-3fbc-4c7c-aeb4-4543eb954311/mark-of-trust-certified-ISOIEC-27001-information-security-management-white-logo-En-GB-1019+copy.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1627900823052-D7TRBUKJM3145YWMN4CJ/ldspot8_templates.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1627901021566-EOCBUK46GYI8A68ENR7U/ldspot3.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1627907353321-48739L3BDZXWFZN2NCL0/unsplash-image-BfrQnKBulYQ.jpg</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1774518382888-I9EZEN4V1OR8B68ZOMCA/ldspot_logos.png</image:loc>
      <image:title>LiveDesign Connector for Spotfire</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1774518384804-RWB5WDMMXD4WLWS4A1U0/ldspot1_ic50.png</image:loc>
      <image:title>LiveDesign Connector for Spotfire</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1774518382889-8EZJAFTOGDXU9ROUKRSU/ldspot5_popout.png</image:loc>
      <image:title>LiveDesign Connector for Spotfire</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1774518383887-L16JMZNLRPN6TFNGRTPI/ldspot3.png</image:loc>
      <image:title>LiveDesign Connector for Spotfire</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1774518383911-DDSA97RGZ67W6IKJMA73/ldspot2.png</image:loc>
      <image:title>LiveDesign Connector for Spotfire</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1627899958509-NZ52S6EUR63J8JEB4AAB/ldspot1_ic50.png</image:loc>
      <image:title>LiveDesign Connector for Spotfire - Side-Panel</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1627894867755-W5NVI9W6TBQ0NXAL00HN/ldspot5_popout.png</image:loc>
      <image:title>LiveDesign Connector for Spotfire - Pop-Out</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1627899958716-19EH33GS1X25TD8SW4X0/ldspot_dual_fullscreen.png</image:loc>
      <image:title>LiveDesign Connector for Spotfire - Multi-Screen</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1627894866546-8TFWH3981QSZJJCSY449/ldspot3.png</image:loc>
      <image:title>LiveDesign Connector for Spotfire - Form View</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1627899960209-QABCPDQ1T217CIX6H1FY/ldspot7_analyst.png</image:loc>
      <image:title>LiveDesign Connector for Spotfire - Spotfire UI Only</image:title>
      <image:caption />
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/3dpredict-ab</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-04-02</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2444b43f-6f93-4048-9303-f3a2526c2199/logo+3dpredictab.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/09f36918-f38f-4fbf-a19e-9a4f2aa847b4/Design+sans+titre+%2811%29.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/b8ce3522-3a93-4532-b442-53792a7e6fb3/Design+sans+titre+%289%29.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/45ae7eef-53b2-4d83-8627-59e617073a8b/Design+sans+titre+%2810%29.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/a00d9a69-6ad5-400a-b98b-c85dfa01ffab/modeling+GIF+smaller+Nov+2025.gif</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/bbd39640-a28e-45b3-9627-62c20a560b7a/Step2+-+calculating+720p.gif</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f8b18462-7c53-4e32-8d8f-76c6d414eca4/screening+720p.gif</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ba4f972b-ca6f-4fa1-a053-63bb08a6a253/analysis+720+p.gif</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/94f13564-05b5-4f70-a3f1-f1e81a7151e3/Residue+plots.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/c408a690-7776-4dd9-9430-f013e5d592fc/CST+overview+tab.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/92aa8a7a-a63e-4a7d-b0d2-74d84e02efa6/Design+sans+titre+%286%29.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6042223c-1259-4a26-b387-71631e722837/cloud</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/299b73bd-263a-4734-be0f-6f3fe6f4f201/Design+sans+titre+%285%29.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8d17ac51-9477-4358-aaec-7255db16e240/CCG_Logo_White_Lettering_20190318+%286%29.png</image:loc>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/ich-m7</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1630708073219-PZK46OX1IEEC1GJIGQEC/Alexander+Amberg.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1631222408467-H3I5T0FG61WWZA56YK4D/Impurity+assessment+process</image:loc>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/home</loc>
    <changefreq>daily</changefreq>
    <priority>1.0</priority>
    <lastmod>2026-04-07</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/fcc31071-fb6c-4657-8814-a33706f9fec8/Abbvie.png</image:loc>
      <image:title>Home</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8bc33eff-8496-49f8-9871-03b2ecd9e0fb/AMGEN.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/8bbf6817-49eb-4d72-b697-69125af770e9/AstraZeneca.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/464985d9-8f47-40ba-bfc8-bb3046a8c86c/Bayer.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/499766a0-69a2-4482-bfcc-8fcda9ba8b93/Biogen.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ac4c2743-82c1-4b5c-bd7f-5f2302b9a74e/BMS.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4721c612-b612-4c10-8d5b-7249106020a1/Eurofins2.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/57921e54-12e5-439d-9b34-62372caa64bd/Evotec.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/a6fbc83c-6a1c-4513-8708-b9120f4c0664/Gilead.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/84ee3641-230a-473d-9686-355726f1834e/GSK2.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/75ce51a7-a9db-461f-b152-f0267cb5f09d/Idorsia2.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/00640fed-fdd8-40d0-b692-368986a927b8/Ipsen.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/083f1caa-effc-4d5c-9fae-c349b775fe89/L%27or%C3%A9al.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1d1c8f70-417f-4012-b81a-6f6e19063479/Merck.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/feeb4264-d220-436a-8fc2-9f0247eada6d/NovoNordisk.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/ca3b0507-bf0e-40c1-8e94-98724a494ca8/new+novartis+logo+2026.jpg</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/80bb66b9-902f-4064-9166-420dcc3a3cc2/Pierre+Fabre.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2650631c-3026-4e76-be39-9a18443835c4/Roche.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2648b23f-df23-4e3c-a0b5-ca79f6d296f5/Sanofi+2.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/a50bc37e-48c0-44b9-9720-049ebbc9f63f/Servier2.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/30c0b5dd-4533-422f-8fa6-aa74448039f8/syngenta2.png</image:loc>
      <image:title>Home</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4e6f49c1-0423-426c-ae40-ae0bd6c20ad8/Logo_Sanofi_%282022%29.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/334fbcb3-3d5e-44c2-b5e3-ba0cc53c745f/image+%283%29.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1773651817481-F65717Q0H7DTUG4NZ8DI/SAR+image+Roll+up+banner+upscale.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/cea6e5e2-8a0b-4adf-9034-f0a55a65b6a7/_3dpredict+COMPUTER_printed+materials+%281%29.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625492830777-J25FNRQAXINNCW3S5FBR/Connector+Concepts.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/b9c1d535-32fd-4b98-9852-ce16a6696408/Service+white+.jpg</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1682546906017-O16VGER99OJ1VEXL5EGM/Nanome.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1682546907406-HRC1QKUQHTL9J79YPCIW/Schrodinger.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1682546905916-V1OS4F52DM9IR0CHCLNC/LabVoice.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1682546906606-TR6981826ACKVE5C3DCC/Oracle.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/37177383-6727-4e70-b31d-68622b0e626a/BIOVIA.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/98c882fb-9bcb-47f5-a85c-7249f8e59928/spotfire-logo+blue.jpg</image:loc>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/livedesign-connector-for-pipeline-pilot</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/f3703f0c-4067-439a-ab51-5fb29a10d96d/mark-of-trust-certified-ISOIEC-27001-information-security-management-white-logo-En-GB-1019+copy.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625816845886-3K1XDGGSV3E8YXT1FUWW/show-Nitrogen-Walk-demo.gif</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625672153469-OAZ1ORX9WR6Q31PRCE4V/ldwapp_prm_mappingpng.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625672337646-Q8CB9OZGUH89VIR65DQ0/LDwapp_form_reg.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625737434130-3Z7NK62LDPZCED8QSEVQ/unsplash-image-BfrQnKBulYQ.jpg</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625738510420-7GOD7QP9ERAVDG8SI687/LDwapp_pp_fullscreen.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625668847077-NJUAZ48F2XA1LWO62260/ldwapp_%2B%2B.png</image:loc>
      <image:title>LiveDesign Connector for Pipeline Pilot</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625650689702-ULRJ4CPDR3O1B03SQ00X/LDwapp_form.png</image:loc>
      <image:title>LiveDesign Connector for Pipeline Pilot</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625668036845-6TSYBDBU7NOPCD6OARIG/LDwapp_pp_fullscreen.png</image:loc>
      <image:title>LiveDesign Connector for Pipeline Pilot</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625650689607-6KL6RSFA5ZHPS0B8B1N3/LDwapp_form_reg.png</image:loc>
      <image:title>LiveDesign Connector for Pipeline Pilot</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625650690203-S4K3Z4W3EXD87BJHXQJI/LDwapp_result.png</image:loc>
      <image:title>LiveDesign Connector for Pipeline Pilot</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625739055740-DHYMUTBGI52R37DX8M1J/ldwapp_arch.png</image:loc>
      <image:title>LiveDesign Connector for Pipeline Pilot</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625739055373-SJNADS5BY4KDECPLSBS5/LDwapp_form.png</image:loc>
      <image:title>LiveDesign Connector for Pipeline Pilot</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625739056114-Q0MGYPUS27YEFYO4R4VG/LDwapp_pp_fullscreen.png</image:loc>
      <image:title>LiveDesign Connector for Pipeline Pilot</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625739056481-23938WP3MPNXJ0T1M60N/LDwapp_result.png</image:loc>
      <image:title>LiveDesign Connector for Pipeline Pilot</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/spotfire-connector-for-knime-server</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/e8137ef4-1e2f-45ee-ad19-9dbf42379677/kn_spot01.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/3fef466c-7d2d-4a16-809e-c46b6de71dd9/mark-of-trust-certified-ISOIEC-27001-information-security-management-white-logo-En-GB-1019+copy.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/4398c112-2750-46cc-9cde-ce6684bc4ff4/kn_spot03.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1647016728326-H2W4M5WIR6V5DK5ZCIDJ/kn_spot02.png</image:loc>
      <image:title>Spotfire Connector for KNIME Server - Design</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1647016728211-8SX98N87NVRG0A4ZJ6B3/kn_spot04.png</image:loc>
      <image:title>Spotfire Connector for KNIME Server - Register</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1647016729802-GRS73027V492XPFF5A8A/kn_spot07.png</image:loc>
      <image:title>Spotfire Connector for KNIME Server - Execute</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1647016728982-XLH52EOGS66XF1II4TUF/kn_spot05.png</image:loc>
      <image:title>Spotfire Connector for KNIME Server - Share</image:title>
      <image:caption />
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1647016729449-G1YLDL8KHHZWGOJ30CW8/kn_spot06.png</image:loc>
      <image:title>Spotfire Connector for KNIME Server - Share in Web Player</image:title>
      <image:caption />
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/chemistry-collection</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/25052468-06cc-492e-b523-81a76eec9507/mark-of-trust-certified-ISOIEC-27001-information-security-management-white-logo-En-GB-1019+copy.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1571958546923-1WRGWW63SGOQRAC6UGED/chemistry_1.png</image:loc>
      <image:title>Chemistry Collection</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1560382474009-I695OJDOOD994SBY9RHN/chemistry_2.png</image:loc>
      <image:title>Chemistry Collection</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1542638747430-1N40TB1BY10NVF4G2579/chemistry_3.png</image:loc>
      <image:title>Chemistry Collection</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/network-collection</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6b3debdc-d506-476d-97a0-709b9bac39fb/mark-of-trust-certified-ISOIEC-27001-information-security-management-white-logo-En-GB-1019+copy.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1542638547725-M77M2EYRC91SOAIEBLNC/Network+Collection.png</image:loc>
      <image:title>Network Collection</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1387540665780-LWJ34IZ6TGYGLE2RAWIK/network_1.png</image:loc>
      <image:title>Network Collection</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/connector</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1625492830777-J25FNRQAXINNCW3S5FBR/Connector+Concepts.png</image:loc>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/services</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1576003086705-OGZHN1RYX53DK6Q9P4HH/Dual-skilled+mindset+HD.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1576003115652-5G2O8XTFOQ4WI8IQZQKU/problem+solving+mindsetHD.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1576003144072-FII9KU62N6AMTHMJGEIM/Industry+Standard+technologyHD.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1574466487362-K179WQRLX7X9O59PK0A4/Agile+methodologies.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1576003172345-AFAO7L33RPSQ20YDASE7/software+editor+experienceHD.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1576003201239-Y657UXUXH809IZ2YGU76/Remote+services+HD.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/2d9f86ba-b19e-4a40-801d-828596272820/social+post+4.png</image:loc>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/ideation-analytics-sar-slides</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-04-03</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/08375922-88e4-45b9-b949-b01ec11b5dba/NEW+-+Logo+discngine+ideation+analytics.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6a133570-19c2-4f96-b6fa-01fd96f8ab98/Design+sans+titre+%285%29.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/a4836985-3bc6-434d-be0e-b75c205bdd90/molecule.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d18d0eda-8d72-40c8-85e9-2a5c0fdbe12c/researcher.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/fc5dbb2a-5706-4a05-9c7f-bffa6b6d467e/Cloud+application.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1ecbfcdc-106d-4796-b0e5-d6cea34dc3bd/GIF+1.gif</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6ffa9f14-6c67-4149-8b95-12d641de8161/gif+3.2.gif</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/6663c5c1-9fbc-4031-9264-21d0aca05d82/GIF+2.gif</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/255f20d8-6caf-44d5-a717-eb3e79c6776d/Design+sans+titre+%284%29.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/5f08f311-b49a-4d8b-ba00-c55eaef5cc7b/integration+icon.jpg</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/282eb670-64c3-4505-993a-8872b9f5db3d/Data+protection.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/772dfbe0-2736-48f7-91ef-21de640fbece/Design+sans+titre+%288%29.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/39cd2e23-aa96-40db-822c-beda422865b3/Instant+deployment.png</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/20986f7c-d25e-472d-978f-4e8b134b28d3/Maud+Bollenbach+Bayer+Crop+Science</image:loc>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/d3f206b2-3b7e-4518-8a03-b8493cc22fea/David+Bernier+Bayer+Crop+Science</image:loc>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/about</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533313715-T5EMIDWMB0X9E4T055VT/Abbvie.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1736282102522-EJHNK1B0XBXE591NQWHA/AMGEN.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533314248-TFD1A15AP2ER5R1XDFLT/AstraZeneca.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1579041152735-6GBINTL7URFQDJO7MQ9C/Bayer2.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1736282109733-QYQKPMIZWCH8HI8RJG54/BMS.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1579041750181-ZT8331OGAFU0BAQ2JAO7/Eurofins2.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533317631-ZB9X0E5DZ8CF6CO9P2G5/Evotec.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533318939-DSDUK0OOIOJY3GFMPLG0/Gilead.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1686061761744-OQDLU9Q4NIA68FSBEVLZ/GSK.png</image:loc>
      <image:title>About us - GSK (Copy)</image:title>
      <image:caption>GSK</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533321733-TE60I1SBX4CL9N75GTWR/L%27ore%CC%81al.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1774894818601-MS79SB87J309X1DLMAO9/Design+sans+titre+%283%29.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1736282095181-ZTDBZBO6K3N8NADY0N27/NovoNordisk.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533323248-047NFKXU37ZSCMHQQG7R/Lundbeck.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533323146-H9C4XPNW2T7XOGUA0T5F/Merck.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533327286-4CF7DIVWCEOCV74NVR72/Pierre+Fabre.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1578533328108-YIJBW1JV11HHEQKDGG0L/Roche.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1644357603220-K4506Z8CVO8GBDIN79IR/Sanofi+2.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1665077411503-QAG0DJ9Z81XS0AAHWMTM/image-asset.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1579041777207-YZX3D7K466PX2RG5ZGJO/syngenta2.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1687805661391-L3CAFKA4WQ0ALNSRZ5LP/Biovia.png</image:loc>
      <image:title>About us - BIOVIA (Copy)</image:title>
      <image:caption>BIOVIA</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1687805661444-AEO1XR1T5RCVJUC63QRF/Knime.png</image:loc>
      <image:title>About us - KNIME (Copy)</image:title>
      <image:caption>KNIME</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1687805662223-KLAHD81837BDFWYBKUUX/Labvoice.png</image:loc>
      <image:title>About us - LabVoice (Copy)</image:title>
      <image:caption>LabVoice</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1687805662301-JPSVKK4UFFBTZZ0VIBQX/Nanome.png</image:loc>
      <image:title>About us - Nanome (Copy)</image:title>
      <image:caption>Nanome</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1687805662866-TQR5QR19EOWM1N40UXUL/Oracle.png</image:loc>
      <image:title>About us - Oracle (Copy)</image:title>
      <image:caption>Oracle</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1687805663604-GXYXAKROPA388FPTN8J7/Schrodinger.png</image:loc>
      <image:title>About us - Schrodinger (Copy)</image:title>
      <image:caption>Schrodinger</image:caption>
    </image:image>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/1774895132816-US59OQ94CH36909HUQFI/Design+sans+titre+%285%29.png</image:loc>
      <image:title>About us</image:title>
    </image:image>
  </url>
  <url>
    <loc>https://www.discngine.com/spotfireconnectorforpipelinepilot</loc>
    <changefreq>daily</changefreq>
    <priority>0.75</priority>
    <lastmod>2026-03-30</lastmod>
    <image:image>
      <image:loc>https://images.squarespace-cdn.com/content/v1/527ce929e4b0d974f5707b6b/71498615-3b48-49d5-b989-6f2f121d0d8b/mark-of-trust-certified-ISOIEC-27001-information-security-management-white-logo-En-GB-1019+copy.png</image:loc>
    </image:image>
  </url>
</urlset>

